Tap / click on image to see more RealViewsTM
$3.15
per postcard
 

Hallow's Eve of Yesteryear Masks Postcard

Qty:
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-$0.30

Other designs from this category

About Postcards

Sold by

Size: Standard Postcard

Create your own vacation-worthy postcard! Any view you’ve seen, any monument you’ve fallen in love with, can all be added to your postcard with our personalisation tool.

  • Dimensions: 14.22 cm L x 10.79 cm H; qualified USPS postcard size
  • High quality, full-colour, full-bleed printing on both sides

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Hallow's Eve of Yesteryear Masks Postcard

Hallow's Eve of Yesteryear Masks Postcard

Turn of the century Halloween costumes have a reputation for being scarier than the contemporary versions. Instead of going for the safe Halloween pumpkin motif add some fright to your style.

Customer Reviews

4.9 out of 5 stars rating16K Total Reviews
14526 total 5-star reviews1021 total 4-star reviews206 total 3-star reviews79 total 2-star reviews131 total 1-star reviews
15,963 Reviews
Reviews for similar products
5 out of 5 stars rating
By Deidre T.9 March 2023Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
Exactly what I wanted, it is very difficult to acquire Vintage Australiana items. I am so please that I ordered 8 I will be using them for my scrap booking and Junk Journaling. Gorgeous, Zazzle produced and delivered exactly what I wanted.
5 out of 5 stars rating
By Deidre T.9 March 2023Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
Way better quality than I ever expected. I love the colours, font and quality of the card. I'm so pleased I found Zazzle as it is near impossible to purchase Vintage or Retro Australian memorabilia online. I chose this design when I purchased them. They are perfect for my projects. I was very specific about what I wanted. I know where to come now when I need to order similar items.
5 out of 5 stars rating
By Michaela A.5 December 2022Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
Perfect for the occasion I was using it for. I was able to delete the lines so I could put in more wording. Had an envelope so the address side wasn't necessary. Print quality and paper quality lovely.

Tags

Postcards
halloweenvintagemasksscarychildrencreepydarkcostumeshomemadehistorical
All Products
halloweenvintagemasksscarychildrencreepydarkcostumeshomemadehistorical

Other Info

Product ID: 239557603624308150
Added on 29/9/15, 8:00 am
Rating: G