Tap / click on image to see more RealViewsTM
$36.10
per sticker
 

Yes Coffee!

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: 35.56 cm x 35.56 cm

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 35.6 cm L x 14.12.7 cm W
  • Design Area: 35.6 cm L x 35.6 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Yes Coffee!

Yes Coffee!

This is customisable, enjoy!

Customer Reviews

3.5 out of 5 stars rating2 Total Reviews
1 total 5-star reviews0 total 4-star reviews0 total 3-star reviews1 total 2-star reviews0 total 1-star reviews
2 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By April T.9 September 2021Verified Purchase
15.24 cm x 15.24 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Not only are these printed stickers colourful, but I love that you can get them in a whole bunch of different sizes! Colourful and bright!
from zazzle.com (US)
2.0 out of 5 stars rating
2 out of 5 stars rating
By Abel S.25 June 2024Verified Purchase
This is the second time I reviewed this design. I don't understand why you can't round the corners on this. Looks terrible with the white square box. . Printing is fine but the die cut lacks big time. Not happy. I wanted this for my truck. Now I just might return it.
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
All Products
coffeesmilehappycafedrinkenergypositive

Other Info

Product ID: 256176895577455177
Added on 11/5/21, 10:18 pm
Rating: G