Tap / click on image to see more RealViewsTM
$19.70
per set of 10 labels
 

yaie mystery 2 food label

Qty:
Food Container Label (5.1 cm x 7.6 cm)
-$7.90
-$7.90
-$9.90
-$11.85
-$7.90
-$7.90

Other designs from this category

About Food and Beverage Label Sets

Sold by

Style: Food Container Label (5.1 cm x 7.6 cm)

Easily customise mason jars or food containers and make them 100% your own. Perfect for weddings, birthday parties, and baby showers.

  • Dimensions: 5 cm x 7.6 cm (2" x 3")
  • Each set includes 10 matte labels
  • Scratch-resistant and waterproof
  • Vibrant, full-colour, photo-quality printing that stands the test of time
  • Easy peel-and-stick method; labels are easily applied by removing the crack and peel backing to expose the permanent adhesive
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 5.3 cm x 7.6 cm (2.1" x 3.01"). For best results please add 0.3 cm (0.12")bleed.

About This Design

yaie mystery 2 food label

yaie mystery 2 food label

yaie mystery 2. Black Friday deals on the street

Customer Reviews

4.9 out of 5 stars rating1.9K Total Reviews
1769 total 5-star reviews84 total 4-star reviews16 total 3-star reviews9 total 2-star reviews31 total 1-star reviews
1,909 Reviews
Reviews for similar products
5 out of 5 stars rating
By Kimberley H.9 November 2021Verified Purchase
Food Container Label (5.1 cm x 7.6 cm)
Zazzle Reviewer Program
I have been reordering these labels for 5 mths now and I can not fault the quality of them. They apply really easily and come off my candle vessels and leave no sticky residue. The customer service is first rate as is the deliver time. I will continue to use Zazzle for all my branding. Thank you! Excellent and very good quality.
5 out of 5 stars rating
By L.13 August 2022Verified Purchase
Food Container Label (7.6 cm x 5.1 cm)
Zazzle Reviewer Program
Fast turn around of labels, within a week international. Exactly as I selected
5 out of 5 stars rating
By Lyn D.9 May 2022Verified Purchase
Food Container Label (5.1 cm x 7.6 cm)
Zazzle Reviewer Program
When I give my product away as a gift they will no exactly what they are getting. The printing was excellent

Tags

Food and Beverage Label Sets
yaeiyaiewiccasatanwitchcraftmangaanimedarkblack
All Products
yaeiyaiewiccasatanwitchcraftmangaanimedarkblack

Other Info

Product ID: 256797795453148292
Added on 11/2/24, 6:01 pm
Rating: G