Tap / click on image to see more RealViewsTM
Sale Price $46.97.  
Original Price $55.25 per shirt
You save 15%

Wine Winemaker Grapevine Grape T-Shirt

Qty:
Basic Dark T-Shirt
-$2.60
+$18.35
Black
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Basic Dark T-Shirt

Comfortable, casual and loose fitting, our heavyweight dark colour t-shirt will quickly become one of your favourites. Made from 100% cotton, it's unisex and wears well on anyone and everyone. We’ve double-needle stitched the bottom and sleeve hems for extra durability. Select a design from our marketplace or customise it to make it uniquely yours!

Size & Fit

  • Model is 188 cm and is wearing a medium
  • Standard fit
  • Garment is unisex sizing
  • Fits true to size

Fabric & Care

  • 100% cotton (Heathers are a cotton/poly blend)
  • Double-needle hemmed sleeves and bottom
  • Imported
  • Machine wash cold

About This Design

Wine Winemaker Grapevine Grape T-Shirt

Wine Winemaker Grapevine Grape T-Shirt

A super grapevine drawing for winemakers and wine lovers who like grapevines. A great design idea also for hobby gardeners who like to grow wine. The grapevine is a great motif for winemakers and wine connoisseurs who love their grapes.

Customer Reviews

4.7 out of 5 stars rating32.8K Total Reviews
25733 total 5-star reviews4985 total 4-star reviews1121 total 3-star reviews511 total 2-star reviews494 total 1-star reviews
32,844 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Rachel R.4 September 2025Verified Purchase
Basic Dark T-Shirt, Black, Small
Ordered the Irish terrier t shirt. I love it! There was a slight issue with sizing ( my fault) but their customer service was amazing. New t shirt within 5 days. I recommend getting 1 to 2 sizes bigger. I am wearing Men's size large.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Robert C.1 March 2022Verified Purchase
Basic Dark T-Shirt, Black, Large
Creator Review
I purchased this to test to see if zazzle was producing good quality. Needless to say, they are. The sizing runs a bit on the small size though. Print quality is perfect. What you see on the screen is what you get.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Sandy S.6 December 2025Verified Purchase
Value T-Shirt, White, Small
WOW! Personalised T-shirts were amazing. Love the online design tool, so versatile and easy to use. Shirts arrived ahead of schedule and exactly how I designed it. Thank you for the awesome service and quality t-shirts. Our class loved them. .

Tags

T-Shirts
winegrapevinewinemakerslikegreatmotifconnoisseurstheirgrapesfarmer
All Products
winegrapevinewinemakerslikegreatmotifconnoisseurstheirgrapesfarmer

Other Info

Product ID: 235321457657820985
Added on 4/1/22, 11:59 am
Rating: G