Tap / click on image to see more RealViewsTM
$4.94
per card
 

Will you be my bridesmaid invite

Qty:
Squared
+$0.35
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-$0.30
+$1.00
+$1.00
+$2.40
+$1.00

Other designs from this category

About Flat Cards

Sold by

Size: 8.9 cm x 12.7 cm

Stand out with custom flat cards, turn this flat card into anything imaginable.

  • Dimensions: 8.89 cm x 12.7 cm (portrait or landscape)
  • High-quality, full-colour, full-bleed printing
  • Print on both sides for no additional cost
  • Add personal photos and text for free

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Will you be my bridesmaid invite

Will you be my bridesmaid invite

A "Will You Be My Bridesmaid?" single-page invitation is a heartfelt and personal way to ask your closest friends or family members to stand by your side on your wedding day. It's a special moment that often involves a touch of elegance and sentimentality. Here's a description of such an invitation: 1. **Elegant Design:** The invitation features a delicate and tasteful illustration, perhaps in muted pastel colours or shades that match your wedding theme. This serves as a symbol of the beauty and growth of your friendship. 2. **Sentimental Quote:** Above the illustration, you may include a meaningful quote or phrase that captures the significance of your friendship and the role you want them to play on your big day. This could be something like, "A sister of the heart," or "Side by side as we say 'I do.'" 3. **Personalisation:** Each invitation is personalised with the recipient's name, adding a warm and intimate touch to the gesture. 4. **Photo of You and the Recipient:** Personalise the invitation, place a cherished photo of you and the recipient together, showcasing a memorable moment from your friendship. This helps evoke nostalgia and reinforces the bond you share. 5. **The "Will You Be My Bridesmaid?" Question:** Beneath the letter, include the all-important question in elegant calligraphy or a beautiful script font: "Will You Be My Bridesmaid?" This is the moment of anticipation and emotion. 6. **Details:** On the invitation, provide logistical details about the wedding day, such as the date, venue, and any other relevant information. Make sure to mention any important dates for bridesmaid-related activities, like dress fittings or bridal showers. 7. **RSVP:** Include a section where they can RSVP or respond with their decision. This can be done with a tear-off section or a QR code linked to an online RSVP form for convenience. **Envelope:** 8. **Matching Envelope:** Choose an envelope that complements the invitation's colour scheme and theme. Seal it with a wax seal or a custom sticker featuring your initials or a wedding motif. **Additional Elements:** 9. **Small Gift:** Consider including a small, meaningful gift, like a piece of jewellery or a personalised item, to make the invitation even more special. This "Will You Be My Bridesmaid?" single-page invite is a beautiful keepsake that not only asks the important question but also celebrates the cherished relationship between you and your bridesmaid-to-be. It's a touching and memorable way to invite them to share in your wedding journey.

Customer Reviews

4.8 out of 5 stars rating102 Total Reviews
93 total 5-star reviews4 total 4-star reviews1 total 3-star reviews1 total 2-star reviews3 total 1-star reviews
102 Reviews
Reviews for similar products
5 out of 5 stars rating
By T.31 July 2022Verified Purchase
Flat Card, Size: 10.8 cm x 14 cm, Paper: Signature Matte, Corner: Squared
Zazzle Reviewer Program
My cards were printed and posted quickly and arrived exactly how I wanted them. Very good quality and easy to customise - with lots of options! Print quality was extremely good quality. It’s important to use a high-quality photo especially when expanding the image.
5 out of 5 stars rating
By S.13 August 2021Verified Purchase
Flat Card, Size: 10.8 cm x 14 cm, Paper: Signature Matte, Corner: Squared
Zazzle Reviewer Program
I loved being able to edit the product as much as I want, I uploaded scanned photos and they printed perfectly. The product itself was exactly what I expected, good quality card, colours were great and photos even better. I’m in Melb, Australia, took about 5 weeks to arrive but expected due to COVID. All the photos printed perfectly, some were downloaded from Instagram and some scanned, they all looked so good. None of them Blurry or pixelated.
5 out of 5 stars rating
By Laura P.26 February 2019Verified Purchase
Flat Card, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Corner: Squared
Zazzle Reviewer Program
Easy to personalise, delivered extremely quickly and brilliant quality. Wouldn't hesitate to recommend!

Tags

Flat Cards
bridesmaidinviteweddingspecialdaygirlfriend
All Products
bridesmaidinviteweddingspecialdaygirlfriend

Other Info

Product ID: 256496839673759173
Added on 6/9/23, 8:31 pm
Rating: G