Tap / click on image to see more RealViewsTM
$3.20
per postcard
 

Vintage Italy Italian Map Travel Postcard

Qty:
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-$0.30

Other designs from this category

About Postcards

Sold by

Size: Standard Postcard

Create your own vacation-worthy postcard! Any view you’ve seen, any monument you’ve fallen in love with, can all be added to your postcard with our personalisation tool.

  • Dimensions: 14.22 cm L x 10.79 cm H; qualified USPS postcard size
  • High quality, full-colour, full-bleed printing on both sides

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Vintage Italy Italian Map Travel Postcard

Vintage Italy Italian Map Travel Postcard

Anyone would love to receive this vintage Italia travel postcard featuring a map of Italy with flowers and bees! Your recipient will appreciate the floral and Italian architecture motif of this postcard!

Customer Reviews

4.9 out of 5 stars rating15.8K Total Reviews
14397 total 5-star reviews1012 total 4-star reviews200 total 3-star reviews69 total 2-star reviews115 total 1-star reviews
15,793 Reviews
Reviews for similar products
5 out of 5 stars rating
By Deidre T.9 March 2023Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
Exactly what I wanted, it is very difficult to acquire Vintage Australiana items. I am so please that I ordered 8 I will be using them for my scrap booking and Junk Journaling. Gorgeous, Zazzle produced and delivered exactly what I wanted.
5 out of 5 stars rating
By Deidre T.9 March 2023Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
Way better quality than I ever expected. I love the colours, font and quality of the card. I'm so pleased I found Zazzle as it is near impossible to purchase Vintage or Retro Australian memorabilia online. I chose this design when I purchased them. They are perfect for my projects. I was very specific about what I wanted. I know where to come now when I need to order similar items.
5 out of 5 stars rating
By Michaela A.5 December 2022Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
Perfect for the occasion I was using it for. I was able to delete the lines so I could put in more wording. Had an envelope so the address side wasn't necessary. Print quality and paper quality lovely.

Tags

Postcards
italyvintagemaptravelitalianitaliafloralflowersbeesarchitecture
All Products
italyvintagemaptravelitalianitaliafloralflowersbeesarchitecture

Other Info

Product ID: 256641283317229366
Added on 9/10/21, 5:01 am
Rating: G