Tap / click on image to see more RealViewsTM
$39.90
$6.65 per sheet of tissue paper
 

Vintage French Poster Cats Girl Milk Tissue Paper

Qty:

Other designs from this category

About Tissue Paper

Sold by

Size: 35.56 cm x 50.8 cm

Customise your own creative tissue paper for gift wrapping. You can add something simple like the recipients’ name, or get fancy by adding a cool design, photo, image, or artwork for a one-of-a-kind look. Add pizazz to any present!

  • Please note that this size tissue arrives folded
  • Dimensions: 35.56 cm L x 50.8 cm W unfolded (35.56 cm L x 25.4 cm W folded)
  • Full colour edge-to-edge print
  • 4535g paper is great for wrapping jewellery, small gifts and party favours
  • 8164g paper is thicker than standard tissue paper and provides more padding for delicate or heavier items
  • Allows for easy stuffing
  • Not intended for food contact use

About This Design

Vintage French Poster Cats Girl Milk Tissue Paper

Vintage French Poster Cats Girl Milk Tissue Paper

Darling French vintage Lait Pur de la Vingeanne Sterilise Art Print by Théophile Alexandre Steinlen, with Cats at the foot of a Girl drinking Milk, is on this Tissue Paper. Image is public domain due to expired copyright.

Customer Reviews

4.8 out of 5 stars rating3K Total Reviews
2752 total 5-star reviews156 total 4-star reviews50 total 3-star reviews26 total 2-star reviews52 total 1-star reviews
3,036 Reviews
Reviews for similar products
5 out of 5 stars rating
By Irene I.31 December 2021Verified Purchase
Custom Tissue Paper - 27 gsm (18lb), Size: 53.34 cm x 73.66 cm
Zazzle Reviewer Program
Unused bedroom fireplace inspired by Leonardo David is red chalk drawings. Absolutely so proud and the overall result total success Magical at night so warm and comforting. Slight differences in depth of colour between sheets but perfectly acceptable as it is bespoke printing.Thrilled.
5 out of 5 stars rating
By Annie S.5 May 2021Verified Purchase
Custom Tissue Paper - 15 gsm (10lb), Size: 25.4 cm x 35.56 cm
Zazzle Reviewer Program
Gorgeous full colour print tissue paper. Ordered the thinnest GSM available in order to decoupage on a bedside table. Turned our great. Vibrant, bright colours. Print is bright and vivid colour. No pixellation. Gorgeous!
4 out of 5 stars rating
By Denise P.28 March 2021Verified Purchase
Custom Tissue Paper - 15 gsm (10lb), Size: 45.72 cm x 60.96 cm
Zazzle Reviewer Program
Tissue paper is fantastic for creative projects such as collage, decoupage and mixed media. The designs are appealing. The colour and quality of paper are acceptable.

Tags

Tissue Paper
tissue papervintage tissue papervintagefrenchcatsgirlmilkephemerakittiespets
All Products
tissue papervintage tissue papervintagefrenchcatsgirlmilkephemerakittiespets

Other Info

Product ID: 256007565250066876
Added on 7/9/19, 6:08 am
Rating: G