Tap / click on image to see more RealViewsTM
$58.15
per roll
 

Viking Pattern Blue Wrapping Paper

Qty:

Other designs from this category

About Wrapping Paper

Sold by

Paper Finish: Glossy Wrapping Paper

Make sure every gift you give has a layer of love by creating custom wrapping paper. Available in four types of premium paper and five different sizes, our wrapping paper covers all your gift wrapping needs - because presentation matters as much as the gift!

  • 64lb print quality glossy paper
  • Ideal for printing photos
  • Full colour edge-to-edge printing
  • Width: 74 cm
  • Length: multiple options from 1.8 m to 18.3 m
  • Each roll up to 4.6 m in length; lengths greater than 4.6 m shipped as multiple 4.6 m rolls
  • Length guide:
    • 1.8 m roll wraps 3 shirt-sized boxes
    • 4.6 m roll wraps 9 shirt-sized boxes
    • 9.1 m roll wraps 18 shirt-sized boxes
    • 13.7 m roll wraps 27 shirt-sized boxes
    • 18.3 m roll wraps 36 shirt-sized boxes
  • Designable area is 91 x 76 cm, but scaled down uniformly and printed at 88.4 x 73.7 cm
  • Please note: Designs are tiled after first 88.4 x 73.7 cm printed section

About This Design

Viking Pattern Blue Wrapping Paper

Viking Pattern Blue Wrapping Paper

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating4.1K Total Reviews
3443 total 5-star reviews382 total 4-star reviews114 total 3-star reviews75 total 2-star reviews107 total 1-star reviews
4,121 Reviews
Reviews for similar products
5 out of 5 stars rating
By Trish C.20 November 2020Verified Purchase
Wrapping Paper, Matte Wrapping Paper
Zazzle Reviewer Program
I needed a vintage looking paper to line some draws of some furniture I upcycled and this gingham paper fit the bill perfectly. The paper was very easy to use and it turned out beautifully. The colour and quality was excellent.
5 out of 5 stars rating
By Siobhan S.31 October 2019Verified Purchase
Wrapping Paper, Glossy Wrapping Paper
Zazzle Reviewer Program
The colours are amazing I will definitely be buying this one again. Excellent.............................................
5 out of 5 stars rating
By Siobhan S.26 October 2019Verified Purchase
Wrapping Paper, Glossy Wrapping Paper
Zazzle Reviewer Program
Looks fantastic on furniture. Excellent....................................

Tags

Wrapping Paper
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256797846469617735
Added on 19/12/16, 7:28 pm
Rating: G