Tap / click on image to see more RealViewsTM
$13.10
per set of 6 labels
 

Viking Pattern Blue Wine Label

Qty:
Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")
-$2.20
-$4.40
+$8.80
+$8.80
+$8.80
+$8.80
+$8.80

Other designs from this category

About Food and Beverage Label Sets

Sold by

Style: Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")

Easily customise a bottle of wine and make it 100% your own by adding a label! Perfect for weddings, bachelor parties and birthday parties.

  • Dimensions: 8.9 cm x 10.1 cm; fits most standard sized wine bottles
  • Each set includes 6 matte labels
  • Scratch-resistant and waterproof
  • Vibrant, full-colour, photo-quality printing that stands the test of time
  • Easy peel-and-stick method; labels are easily applied by removing the crack and peel backing to expose the permanent adhesive
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 8.9 cm x 10.1 cm. For best results please add a 3 mm bleed.

About This Design

Viking Pattern Blue Wine Label

Viking Pattern Blue Wine Label

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.9 out of 5 stars rating1.9K Total Reviews
1723 total 5-star reviews84 total 4-star reviews13 total 3-star reviews9 total 2-star reviews25 total 1-star reviews
1,854 Reviews
Reviews for similar products
5 out of 5 stars rating
By A.15 August 2023Verified Purchase
Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")
Zazzle Reviewer Program
Love this label it was so easy to apply and looked amazing the quality was great I will definitely be ordering more. Everything about this label was amazing the quality and colour and photo was so clean and perfect
5 out of 5 stars rating
By N.3 June 2022Verified Purchase
Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")
Zazzle Reviewer Program
Thrilled with product and service will use again for next 50th Thankyou. Totally Satisfied with everything
5 out of 5 stars rating
By Allanah S.10 June 2024Verified Purchase
Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")
It was a really beautiful touch to our wine bottles for our baby shower but we got gipped a few stickers short!! Awesome printing looks good

Tags

Food and Beverage Label Sets
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256235785226518717
Added on 18/11/17, 11:50 am
Rating: G