Tap / click on image to see more RealViewsTM
$31.40
per mug
 

Viking Pattern Blue Two-Tone Coffee Mug

Qty:
Two-Tone Mug
-$1.90
+$1.85
Black

Other designs from this category

About Mugs

Sold by

Style: Two-Tone Mug

Add a pop of colour to your morning coffee! The outside of the mug features a bright white base for your photo, logo, pattern, or saying, while the inside is vividly glazed in rich colour. Give this fun gift to a friend, or add some zest to your dinnerware collection.

  • Available in 325 ml or 443 ml
  • Dimensions:
    • 325 ml: 8.1 cm D x 9.7 cm H
    • 443 ml: 8.6 cm D x 11.4 cm H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Viking Pattern Blue Two-Tone Coffee Mug

Viking Pattern Blue Two-Tone Coffee Mug

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating22.2K Total Reviews
19640 total 5-star reviews1896 total 4-star reviews329 total 3-star reviews142 total 2-star reviews227 total 1-star reviews
22,234 Reviews
Reviews for similar products
5 out of 5 stars rating
By Lynette B.11 January 2022Verified Purchase
Classic Mug, 325 ml
Zazzle Reviewer Program
A good quality mug comparatively priced. I put 3 individual pictures of 3 of our grandchildren on a mug for my husband. The quality of the printing is great! He loves it! Was worth the time it took to order just for the smile on his face
5 out of 5 stars rating
By Amber M.30 June 2019Verified Purchase
Two-Tone Mug, 325 ml
Zazzle Reviewer Program
Great product that I have ordered over & over again! Good quality printing, & the personalistion (their name) leave my staff smiling!
5 out of 5 stars rating
By Sharon C.7 December 2020Verified Purchase
Two-Tone Mug, 325 ml
Creator Review
I've been using the mug now for some time and I'm very happy that putting it through a dishwasher cycle numerous times has not effected the print or the look of the mug at all. The quality is very good. Great quality printing vibrant, sharp colours

Tags

All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 168824120322378292
Added on 19/12/16, 7:15 pm
Rating: G