Tap / click on image to see more RealViewsTM
$52.95
each
 

Viking Pattern Blue Tote Bag

Qty:
  1. Style

  2. Size

Other designs from this category

About Totes

Sold by

Style: All-Over-Print Tote Bag, Medium

The classic tote with a modern twist: all-over-print allows for 100% customisation, bringing the basic tote to the next level. Your next shopping trip just got a little more earth-friendly and a lot more stylish!

  • Dimensions: 40.6 cm l x 40.6 cm w; Strap: 71.1 cm l
  • Material:
    • Exterior: 100% sturdy brushed polyester
    • Interior: 100% polyester nonwoven laminate
  • 100% cotton web handles
  • Printed then sewn for edge-to-edge designs
  • Black laminated lining for extra support
  • Spot or dry clean only
  • Made in the USA

About This Design

Viking Pattern Blue Tote Bag

Viking Pattern Blue Tote Bag

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.9 out of 5 stars rating2.3K Total Reviews
2156 total 5-star reviews119 total 4-star reviews18 total 3-star reviews7 total 2-star reviews19 total 1-star reviews
2,319 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Maria T.2 November 2024Verified Purchase
All-Over-Print Tote, Shoulder Tote, Medium
I LOVED this bag! The colours are vibrant and the quality of the bag itself is great. It’s polyester but it’s sturdy and the base sits flat on the ground so it’s able to stand up without falling over when there’s contents in it. I’m really happy with the bold and bright colours and how this bag has turned out. Thanks Zazzle!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Rosalind C.18 October 2018Verified Purchase
All-Over-Print Tote, Shoulder Tote, Medium
Zazzle Reviewer Program
Thank you for a great job. The artwork came up beautifully and the colours look great. Quick delivery also. Wonderful. Very accurate to the true colours of the paintings.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Phylis9 January 2023Verified Purchase
All-Over-Print Tote, Shoulder Tote, Medium
Zazzle Reviewer Program
I used this with my Customised Art on it for a Gift and sent it for Christmas, the recipient absolutely loved it, Thank you. Perfect, Thank you so very much I will be doing more with my Art on them

Tags

Totes
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256198166661462734
Added on 28/7/17, 10:07 pm
Rating: G