Tap / click on image to see more RealViewsTM
$59.00
per tie
 

Viking Pattern Blue Tie

Qty:

Other designs from this category

About Ties

Sold by

Style: Tie

Upgrade your wardrobe with a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 139 cm
    • Width: 10.1 cm (at widest point)
  • Printed in vibrant full colour
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customise
  • Dry clean only

About This Design

Viking Pattern Blue Tie

Viking Pattern Blue Tie

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.5 out of 5 stars rating2.5K Total Reviews
1827 total 5-star reviews329 total 4-star reviews136 total 3-star reviews70 total 2-star reviews109 total 1-star reviews
2,471 Reviews
Reviews for similar products
5 out of 5 stars rating
By Amy C.17 May 2022Verified Purchase
Tie
Zazzle Reviewer Program
It's absolutely perfect!! Turned out much better then I expected ❤️ It is a little expensive but very worth it. Printing is perfect can read it very well
4 out of 5 stars rating
By Anonymous14 September 2025Verified Purchase
Tie
I originally ordered 1 tie to test and ensure I liked it with the suits we had ordered! The tie came and it was perfect! We loved it! The colours were bright and the tie was beautifully made. I then ordered the 6 additional ties and the colours are slightly different. The 6 ties were a little less vibrant and the white background was slightly different! .
5 out of 5 stars rating
By Natalie-Ann G.15 July 2019Verified Purchase
Tie
Zazzle Reviewer Program
Thanks for delivering this wonderful tie for my best friends 40th 90s theme birthday party. My partner and I are dressing up as Mulder and Scully and the tie is very Mulderish. The character should have worn one in the show. Tie arrived quickly and everything went smoothly with the purchase. Would highly recommend Zazzle to other shoppers. 👽😃. Exactly like picture

Tags

Ties
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 151059692602002001
Added on 28/7/17, 10:06 pm
Rating: G