Tap / click on image to see more RealViewsTM
$176.00
per throw blanket
 

Viking Pattern Blue Throw Blanket

Qty:

Other designs from this category

About Throw Blankets

Sold by

Size: Throw Blanket

This all-season throw blanket is designed for curling up with a cup of hot cocoa or relaxing on a summer evening with a cool glass of lemonade. Put a unique and stylish touch on your décor with your favourite patterns or designs or make one with your family photo memories for grandparents, moms, and dads!

  • Dimensions: 137.16 cm l x 96.52 cm w
  • Material: 100% polyester; soft touch
  • Hand wash cold. Do not bleach. Line dry. Do not wring.
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 140 cm x 88.26 cm

About This Design

Viking Pattern Blue Throw Blanket

Viking Pattern Blue Throw Blanket

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.6 out of 5 stars rating186 Total Reviews
140 total 5-star reviews34 total 4-star reviews6 total 3-star reviews3 total 2-star reviews3 total 1-star reviews
186 Reviews
Reviews for similar products
4 out of 5 stars rating
By D.1 January 2018Verified Purchase
Throw Blanket
Zazzle Reviewer Program
I ordered 3 throw rugs for my children for Christmas. Ordering was very easy and arrived very quickly. Over all I was delighted with the quality but thought the throw rug looked more like a floor mat but was still very nice. The kids loved them! Mostly the printing was very good but a small amount of photos had a ‘grainy’ look to them. That could have been the quality of the actually photo.
5 out of 5 stars rating
By Poppy E.8 June 2020Verified Purchase
Throw Blanket
Zazzle Reviewer Program
My blanket looks amazing, it’s exactly how I wanted it. Really happy with the results as it’s for my elderly mum with dementia. Also my original order didn’t arrive and zazzle were straight into it and re- sent out another blanket. Excellent company to deal with, I highly recommend them. Thank you. Excellent quality, the photos were all very clear
5 out of 5 stars rating
By Antique I.15 November 2021Verified Purchase
Throw Blanket
Creator Review
A beautiful small blanket that is perfect for covering your legs while curled up in front of the fire, or for a decorative touch on the sofa. We also think it looks brilliant as a Christmas table centerpiece. We are delighted with it. The colors are absolutely perfect. Vibrant yet traditional. The pattern retains its lovely details despite the texture of the fabric. Very classy product that will not disappoint as a gift.
from zazzle.com (US)

Tags

Throw Blankets
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256771172664853319
Added on 18/11/17, 12:55 pm
Rating: G