Tap / click on image to see more RealViewsTM
$18.50
$1.85 per sheet
 

Viking Pattern Blue Stationery

Qty:
Thin Matte Paper

4.1pt thickness / 80 lb weight
Crisp white, matte finish

+$0.23
+$0.23
+$0.23

Other designs from this category

About Stationery

Sold by

Size: 14 cm x 21.6 cm

The paper you write on can say just as much as the words written on it, so make your notes stand out with stationery for your home and office. Choose from 5 different paper types and write letters and business correspondence that will make everyone take notice!

  • 21.6 cm l x 14 cm w (portrait) or 14 cm l x 21.6 cm w (landscape)
  • Choice of five paper types
  • High quality, full-colour, full-bleed printing
  • Creator Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 14 cm x 21.6 cm. For best results please add 1.5 mm bleed

Paper Type: Thin Matte Paper

Your business and personal mailings will have a crisp professional look on this matte. Contains 50% recycled content (10% post-consumer and 40% pre-consumer waste).

About This Design

Viking Pattern Blue Stationery

Viking Pattern Blue Stationery

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating408 Total Reviews
334 total 5-star reviews45 total 4-star reviews19 total 3-star reviews4 total 2-star reviews6 total 1-star reviews
408 Reviews
Reviews for similar products
4 out of 5 stars rating
By Tracey H.27 September 2020Verified Purchase
Stationery Paper, Size: 14 cm x 21.6 cm, Paper: Thin Matte Paper, Envelopes: None
Zazzle Reviewer Program
This product, in itself is very good - good quality, bright colours and exactly as it looks on the website, however, I was quite disappointed when it arrived, as I was expecting the stationary to be in A4 size, when in fact it was only A5. It is still perfectly usable but I'll end up using twice as much when writing letters to friends & family. Zazzle, please make clear on your website what the sizes are when being purchased. Other than that, I have no issues whatsoever with everything I've purchased so far, everything is of an excellent quality and the delivery times are amazingly quick. I will keep purchasing from Zazzle and recommend them to everyone at every opportunity. Keep up the excellent work! The printing is exactly as shown on the website. The colours are vivid and design is great. My only wish is that you give the option of A4 size in stationary writing paper.
1 out of 5 stars rating
By M B.8 April 2024Verified Purchase
Stationery Paper, Size: 14 cm x 21.6 cm, Paper: Thin Matte Paper, Envelopes: None
I have ordered this product previously, however, last time it was a far better product. This time round, I’m very disappointed in the quality. The paper is cheap and not the same weight, the colour is not crisp and the envelop that zazzle recommended is not fit for purpose. The pairing of these products was set by zazzle and they do not work together. Probably find a more reputable site that is able to be contacted quickly- within Australia. Ok- but paper weight is not as advertised
5 out of 5 stars rating
By Brendon N.20 June 2025Verified Purchase
Stationery Paper, Size: 14 cm x 21.6 cm, Paper: Thin Matte Paper, Envelopes: None
Great job! Love the work done!

Tags

Stationery
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 229486491158181475
Added on 18/11/17, 12:08 pm
Rating: G