Tap / click on image to see more RealViewsTM
$39.20
per stocking
 

Viking Pattern Blue Small Christmas Stocking

Qty:
Small
Brushed Poly
Red Back Panel

Other designs from this category

About Christmas Stockings

Sold by

Size: Christmas Stocking 23 cm x 41 cm (9" x 16")

Stop Santa in his tracks this year with fabulous one-of-a-kind stockings. Made from bright and vividly printed polyester, these stockings are too pretty for coal. Give holiday cheer when you gift a 100% personalised stocking decorated with favourite pictures, treasured memories, cherished quotes, and more. The perfect addition to brighten any holiday mantle decor.

  • Dimension: 22.8 cm x 40.6 cm
  • Material: Available in 3 different styles; all 100% polyester
  • Sturdy sewn-in loop for hanging
  • Machine washable, lay flat to dry
  • Made in USA

About This Design

Viking Pattern Blue Small Christmas Stocking

Viking Pattern Blue Small Christmas Stocking

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating443 Total Reviews
358 total 5-star reviews60 total 4-star reviews10 total 3-star reviews6 total 2-star reviews9 total 1-star reviews
443 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jaime S.26 December 2022Verified Purchase
Double Sided Print Christmas Stocking, Brushed Poly
Zazzle Reviewer Program
Great quality excellent printing. Excellent great quality
5 out of 5 stars rating
By Anonymous10 December 2024Verified Purchase
Red Back Panel Christmas Stocking, Brushed Poly
Love it. Perfect size for our large dog. Got it in time for Christmas, now time to fill it. Thank you very much from Huxley.
5 out of 5 stars rating
By Anonymous16 December 2024Verified Purchase
Double Sided Print Christmas Stocking, Brushed Poly
Exactly what I ordered. I have to admit I didn't quite measure the stocking, I got large size and it's massive. I thought it was standard stocking size. I was wrong. Very impress. Can not fault it.

Tags

Christmas Stockings
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256886378358240183
Added on 18/11/17, 12:42 pm
Rating: G