Tap / click on image to see more RealViewsTM
$132.00
per skateboard
 

Viking Pattern Blue Skateboard

Qty:

Other designs from this category

About Skateboards

Sold by

Deck Type: 19.68 cm Skateboard Deck

Whether you're doing grinds on the half-pipe or kickflips in the street, this competition-shaped board has excellent pop! Our decks are crafted from the finest quality hard-rock maple, and with our unique printing process, you get the best skateboard available worldwide.

  • Professional quality skateboard deck made from the highest quality materials
  • Seven plies of premium USA Maple sourced from the Great Lakes region
  • Skateboard-specific glue from Franklin.

Complete Your Board: None

Get the complete board. We’ll add Independent or Krux trucks (depending on the deck style), Bullet bearings, Ricta wheels, mounting hardware and grip tape.

About This Design

Viking Pattern Blue Skateboard

Viking Pattern Blue Skateboard

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating165 Total Reviews
141 total 5-star reviews16 total 4-star reviews2 total 3-star reviews2 total 2-star reviews4 total 1-star reviews
165 Reviews
Reviews for similar products
5 out of 5 stars rating
By William B.25 July 2019Verified Purchase
19.68 cm Skateboard Deck
Zazzle Reviewer Program
I was surprised by just how great this board is. Very smooth ride. Perfect. The design has a lot of details and they all came through.
from zazzle.com (US)
5 out of 5 stars rating
By Sal T.31 January 2024Verified Purchase
19.68 cm Skateboard Deck
Zazzle Reviewer Program
It is great quality pictures is clear , I only ordered 1 incase but it’s heaps good plan on saving and designing more. Awsome I was worried but now heaps satisfied
5 out of 5 stars rating
By FloWink D.12 November 2025Verified Purchase
19.68 cm Skateboard Deck
Creator Review
Vivid colors and awesome quality as I expect from Zazzle! .
from zazzle.com (US)

Tags

Skateboards
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 186963021895698856
Added on 18/11/17, 4:53 pm
Rating: G