Tap / click on image to see more RealViewsTM
Sale Price $48.03.  
Original Price $56.50 per wood art stamp
You save 15%

Viking Pattern Blue Rubber Stamp

Qty:
  1. Size

  2. Handle

  3. Ink Pad colour: None

Other designs from this category

About Wood Art Stamps

Sold by

Size: 5 cm x 5 cm

Put your mark on it. Upload a design, logo, pattern, or text to create a custom maple wood stamp that's all yours. Laser-engraved on a foam cushion for crisp, clean impressions every time. Great for scrapbooking, card making, gift tags, packaging, and any paper craft that needs a personal touch.

  • Available in six sizes
  • Optional wooden handle for easier stamping
  • Optional Color Box® permanent ink pad (10.2 cm L x 1.3 cm W x 6.4 cm H, raised pad surface)
  • Additional Color Box® ink pad colors available here
This product is recommended for ages 13+

About This Design

Viking Pattern Blue Rubber Stamp

Viking Pattern Blue Rubber Stamp

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating3.1K Total Reviews
2617 total 5-star reviews259 total 4-star reviews72 total 3-star reviews56 total 2-star reviews94 total 1-star reviews
3,098 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Sharon T.21 May 2023 • Verified Purchase
2.5 cm x 2.5 cm Wood Art Rubber Stamp, Ink Pad Color = None, Orientation = Horizontal, Handle = Wooden Handle
Zazzle Reviewer Program
Zazzle were easy to deal with and product arrived on time. Love my stamp to personalise my farm fresh eggs !!! Easy to use and everyone loves my farm fresh eggs with the stamp on them.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Melissa29 December 2020 • Verified Purchase
5 cm x 5 cm Wood Art Rubber Stamp, Ink Pad Color = None, Orientation = Horizontal, Handle = Wooden Handle
Zazzle Reviewer Program
This was my first attempt at designing a logo and stamp. Was impressed with the result. The time from ordering to delivery took a bit of time, but definitely worth the wait. The printing to the stamp is clear and concise to my drawing I uploaded. Was very happy with how good the stamp looked, will be ordering others.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous29 July 2019 • Verified Purchase
5 cm x 5 cm Wood Art Rubber Stamp, Ink Pad Color = None, Orientation = Horizontal, Handle = No Handle
Zazzle Reviewer Program
The rubber stamp is nicely made! Creating clothing tags for my boutique fashion label is now easy and fun! It gives a nice DIY look to my clothing tags. So nice!

Tags

scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256160543776141113
Added on 20/11/17, 11:38 am
Rating: G