Tap / click on image to see more RealViewsTM
$34.20
per wood art stamp
 

Viking Pattern Blue Rubber Stamp

Qty:
Wooden Handle
-$1.30
None
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45
+$18.45

Other designs from this category

About Wood Art Stamps

Sold by

Size: 5 cm x 5 cm

Transform any craft project with a personalised maple wood stamp. Leave an impression by uploading a design, image, pattern, or text to make your unique stamp.

  • Available in six sizes
  • Laser engraved on foam cushion
  • Optional wooden handle
  • Optional Colour Box® ink pad is permanent ink for scrapbooking and paper craft projects
  • Additional Colour Box® ink pads in a variety of colours can be found by following this Link
  • Ink pad size: 10.16 cm L x 6.35 cm W x 1.27 cm D
  • Raised pad surface
This product is recommended for ages 13+

About This Design

Viking Pattern Blue Rubber Stamp

Viking Pattern Blue Rubber Stamp

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating3K Total Reviews
2545 total 5-star reviews255 total 4-star reviews68 total 3-star reviews43 total 2-star reviews73 total 1-star reviews
2,984 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous29 July 2019Verified Purchase
Zazzle Reviewer Program
The rubber stamp is nicely made! Creating clothing tags for my boutique fashion label is now easy and fun! It gives a nice DIY look to my clothing tags. So nice!
5 out of 5 stars rating
By M.29 December 2020Verified Purchase
Zazzle Reviewer Program
This was my first attempt at designing a logo and stamp. Was impressed with the result. The time from ordering to delivery took a bit of time, but definitely worth the wait. The printing to the stamp is clear and concise to my drawing I uploaded. Was very happy with how good the stamp looked, will be ordering others.
5 out of 5 stars rating
By Tash C.22 October 2019Verified Purchase
Zazzle Reviewer Program
I couldn't wait for my stamp to arrive, I have been checking every single day and today it came! It's perfect! It even came with an ink pad though the info said it didn't so that's another plus. I loved how easy it was to design my stamp and it came out so well! The lines are very crisp but its made with good quality materials so the lines were perfect every time. The ink is fast drying too so there were no smudges or marks on the other pages. I am so overwhelmingly happy with my purchase. Now I can start going through my enormous collection of books and stamp every last one! The printing is so good, I was a little worried the cut wouldn't be deep enough and if i pressed too hard it could smudge or the base would touch the paper but this wasn't the case. The rubber is solid and the ink is fast drying so after stamping 10 books not a single smudge!

Tags

Wood Art Stamps
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256160543776141113
Added on 20/11/17, 11:38 am
Rating: G