Tap / click on image to see more RealViewsTM
$19.70
per pad
 

Viking Pattern Blue Post-it Notes

Qty:
10.2 x 7.6 cm
+$12.40
-$2.45
+$34.65

Other designs from this category

About Post-it® Notes

Sold by

Size: Post-it® Notes 10.2 cm x 7.6 cm (4" x 3")

When your mind is brimming with to-dos, keep it together with a pad of custom 3M Post-it® Notes. Jot down urgent memos, lists, or a sweet note to special someone such as, "Do NOT forget the milk!" Each 10.1 cm x 7.6 cm pad comes with 50 sticky notes printed in full colour with your graphics, text, or photos. If Post-it® Notes are going to be on your desk anyway, they might as well be creatively personal.

  • Authentic 3M Post-it® Notes
  • Dimensions: 10.1 cm x 7.6 cm (Adhesive side: 10.1 cm edge)
  • Printed in full colour on 50-sheet white Post-it® Notes paper
  • Buy in bulk and save
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 10.1 cm x 7.1 cm. For best results please add 0.15 cm (.12") bleed..

About This Design

Viking Pattern Blue Post-it Notes

Viking Pattern Blue Post-it Notes

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating1.9K Total Reviews
1681 total 5-star reviews174 total 4-star reviews36 total 3-star reviews9 total 2-star reviews17 total 1-star reviews
1,917 Reviews
Reviews for similar products
5 out of 5 stars rating
By Ashima G.26 August 2021Verified Purchase
Post-It® Notes, 10.2 x 7.6 cm
Zazzle Reviewer Program
Working from home, I wanted some special stationary. Was looking for sticky notes and came across this design which I personalised and use all the time. They are great quality and give some added bling to my day. The colours turned out better than I expected and having my name printed gave it a personal touch and goes well with my other stationary.
5 out of 5 stars rating
By Jill M.9 December 2019Verified Purchase
Post-It® Notes, 7.6 x 7.6 cm
Zazzle Reviewer Program
I am very pleased with the post-it notes for my granddaughters. Thank It is wonderful being able to personalise the notes and delivery was very quick. Exactly as I wanted.
5 out of 5 stars rating
By Martine’s S.21 February 2024Verified Purchase
Post-It® Notes, 10.2 x 7.6 cm
Zazzle Reviewer Program
Very happy with the size. Great product for rebooking appointments. Printing is very good

Tags

Post-it® Notes
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256866823467017474
Added on 19/11/17, 10:08 am
Rating: G