Tap / click on image to see more RealViewsTM
$26.40
$3.30 per paper plate
 

Viking Pattern Blue Paper Plate

Qty:
17.78 cm Round Paper Plate
+$0.55
-$0.45

Other designs from this category

About Paper Plates

Sold by

Size and Style: 17.78 cm Round Paper Plate

Throw a spectacular party with fully customisable paper plates to match your theme! Each set of eight paper plates is printed on durable paper stock and decorated with your custom designs or photos. These plates are perfect for serving cake, appetizers, or salads. Order these with our paper napkins for a complete set of party tableware that your guests will love!

  • Dimensions: 17.8 cm diameter
  • FDA compliant for food contact safety
  • Perfect for cake, appetizers, or salads
  • Printed in USA

About This Design

Viking Pattern Blue Paper Plate

Viking Pattern Blue Paper Plate

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.6 out of 5 stars rating1.3K Total Reviews
1078 total 5-star reviews98 total 4-star reviews39 total 3-star reviews37 total 2-star reviews54 total 1-star reviews
1,306 Reviews
Reviews for similar products
5 out of 5 stars rating
By Christine L.6 December 2022Verified Purchase
Paper Plates, 17.78 cm Round Paper Plate
Zazzle Reviewer Program
I was very impressed the plates were Beautifully done and got exactly what i ordered. The family had a pre Christmas get together, where the children come to decorate the tree. Once done the food platters come out and so did the plates. they were an absolute hit with the family so much so that nobody wanted to eat off them🥰 they made for a good conversational piece around the table. I will certainly be purchasing more from Zazzle. Thankyou. Awesome printing. You did not disappoint. 👏
5 out of 5 stars rating
By Ebru a.16 August 2023Verified Purchase
Paper Plates, 17.78 cm Round Paper Plate
Zazzle Reviewer Program
Amazing!!!! I love the design it’s perfect i teared up when I opened the package cant wait till my sons birthday party 🥳 best seller I definitely recommend and I’ll definitely be buying off her every year for any birthday i have coming up. Perfecttttttttt!!! Couldn’t be any happier
5 out of 5 stars rating
By Julie b.7 June 2025Verified Purchase
Paper Plates, 22.86 cm Round Paper Plate
Absolutely beautiful will order again for the next birthday Thankyiu .

Tags

Paper Plates
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256625107117526098
Added on 18/11/17, 11:39 am
Rating: G