Tap / click on image to see more RealViewsTM
$35.05
per spiral notebook
 

Viking Pattern Blue Notebook

Qty:
21.6 cm x 27.9 cm
Wide Ruled
Black

Other designs from this category

About Spiral Notebooks

Sold by

Style: 21.6 cm x 27.9 cm

Accessorise while you organise with these hand made spiral notebooks. The front and back covers are customisable with your images and text, and the notebook covers are laminated to ensure durability. Choose from 4 notebook styles, hardcover or softcover versions, 7 different spiral colours and 10 page design options to make your one-of-a-kind notebook today.

  • Dimensions: 21.6 cm l x 28 cm w
  • Hardcover or Softcover
  • Page Count: 60 sheets, 120 pages
  • 60 lb. durable text smooth paper
  • Laminated front and back covers, plain white inside
  • Choice of 7 colours for the spiral
  • Choice of 10 designs for the pages
  • CPSIA compliant
  • Suitable for ages 4+

About This Design

Viking Pattern Blue Notebook

Viking Pattern Blue Notebook

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating871 Total Reviews
788 total 5-star reviews57 total 4-star reviews9 total 3-star reviews4 total 2-star reviews13 total 1-star reviews
871 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Melanie C.2 August 2020Verified Purchase
21.6 cm x 27.9 cm, Black spiral, Wide Ruled pages
Zazzle Reviewer Program
Of all the online options for personalised notebooks this was the most adaptable and an amazing price. Made the perfect personalised first paper anniversary gift. Perfect,& high quality thick gloss cover
5.0 out of 5 stars rating
5 out of 5 stars rating
By J.30 May 2023Verified Purchase
21.6 cm x 21.6 cm, Gold spiral, Sketch pages
Zazzle Reviewer Program
Personalising my product was super easy. I loved that you could see the preview updating as you edited the product, and also that you could choose from many different fonts and which border for the inside pages. I’ve never seen a guest book with a lovely image before, only really with the words ‘Guest Book.’ The whole process was great and the product is beautiful! The printing is fantastic! I love the gloss cover, the inside pages are also beautiful. The printing is very clear. Looks just as shown on the website.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Toni V.28 June 2026Verified Purchase
21.6 cm x 21.6 cm, Black spiral, Wide Ruled pages
Beautiful celebration of life guest book for my parents in law who passed away together in life & death. A great keepsake for the family. .

Tags

Spiral Notebooks
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256901698435672199
Added on 19/11/17, 10:12 am
Rating: G