Tap / click on image to see more RealViewsTM
$81.25
per set of 50 napkins
 

Viking Pattern Blue Napkin

Qty:
White

Other designs from this category

About Paper Napkins

Sold by

Style: Coined Cocktail

A good celebration is as much about the presentation as it is about food. Serve up the party with custom personalised paper napkins that look good tucked in the collar or draped over your lap.

  • Dimensions: 12 cm l x 12 cm w (folded), 3 ply
  • Printed in full colour on your choice of white or ecru coloured napkins
  • Coined or standard napkin styles available
  • Sold in quantities of 50
  • Buy in bulk and save!
  • This product is food contact safe
Tip: When ordering napkins, the general rule is 3 napkins per guest.

About This Design

Viking Pattern Blue Napkin

Viking Pattern Blue Napkin

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating3.1K Total Reviews
2610 total 5-star reviews236 total 4-star reviews77 total 3-star reviews56 total 2-star reviews108 total 1-star reviews
3,087 Reviews
Reviews for similar products
5 out of 5 stars rating
By K.7 February 2022Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
Cocktail napkins turned out exactly as they were presented when creating the custom online order with my logo for them. It was easy to customise my order and go back to review, double check, change and/or revise before finalising. Also good options on discounts for increased qtys. I received them 11days after ordering all the way across to Western Australia. Most Eastern States orders straight off a shelf aren’t even that quick. I recommend Zazzle highly, just make sure you get it right when submitting a custom order. The print quality was exactly as per my logo I sent on their online platform for custom orders.
5 out of 5 stars rating
By Bethany R.5 May 2020Verified Purchase
Paper Napkins, Coined Cocktail
Zazzle Reviewer Program
Extremely happy with my order. Exactly as I had hoped they would be! Also arrived 2 weeks earlier than I expected too. Super fast shipping, thought it would take 2-3 weeks from ordering but they literally arrived within a week after I ordered them! Printing is perfect, design came out exactly as I had made it. Will definitely be ordering from Zazzle again in future.
5 out of 5 stars rating
By B.15 May 2023Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
Ordered these for our engagement party and the quality is exactly what we expected. The printing looks great she the shopping was fast. Image quality was perfect and the printing colour looks great.

Tags

Paper Napkins
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256214417618707333
Added on 18/11/17, 4:46 pm
Rating: G