Tap / click on image to see more RealViewsTM
$24.10
per tag
 

Viking Pattern Blue Luggage Tag

Qty:

Other designs from this category

About Luggage Tags

Sold by

Style: Double-sided

Stand out in a crowd at the baggage carousel with a custom luggage tag from Zazzle! Sturdy and weatherproof, this luggage tag is ready to stand up to the travel demands of any road warrior or adventure seeker. Printed using the AcryliPrint®HD printing process, your baggage tag shows designs, text, and photos in vibrant clarity and brilliant colors. Customise it with your information and escape bag mix-ups for years to come!

  • Dimensions: 5.1 cm l x 8.9 cm w (standard business card size)
  • Made of ultra-durable acrylic
  • UV resistant and waterproof
  • Leather luggage strap included
  • Printed on both sides
This product is recommended for ages 13+

About This Design

Viking Pattern Blue Luggage Tag

Viking Pattern Blue Luggage Tag

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.9 out of 5 stars rating4.5K Total Reviews
4088 total 5-star reviews301 total 4-star reviews75 total 3-star reviews19 total 2-star reviews29 total 1-star reviews
4,512 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous19 July 2025Verified Purchase
Acrylic Luggage Tag
Fantastic value loved it thank thank you nice surprise to get it 5 star service communication was excellent postage was good well protected p.
4 out of 5 stars rating
By Cat M.19 December 2019Verified Purchase
Acrylic Luggage Tag
Zazzle Reviewer Program
I was happy with the acrylic tag but it came with a thin leather strap to attach the tag to luggage (like a cat collar). I replaced the strap with a metal ring off of a key ring as the leather strap would come undone or break easily as luggage is sometimes handled without much care by airlines. Printing is great. Colours and positioning of the design I put on the tag were perfect. Very pleased.
5 out of 5 stars rating
By Shane H.19 August 2025Verified Purchase
Acrylic Luggage Tag
Love these. They are well made, look amazing. So happy with this purchase. Thank you.

Tags

Luggage Tags
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256722126263163913
Added on 28/7/17, 10:01 pm
Rating: G