Tap / click on image to see more RealViewsTM
$87.95
per clock
 

Viking Pattern Blue Large Clock

Qty:
27.3 cm Round Acrylic
-$10.10
-$19.95
-$19.95
-$19.95

Other designs from this category

About Wall Clocks

Sold by

Style: 27.3 cm Round Acrylic Wall Clock

Customise your wall clock to create a functional wall décor statement piece to perfectly match your home décor, show off your art or favourite photo, or give as a personalised gift. This unique, high-quality wall clock is vibrantly printed with AcryliPrint®HD process and features a pre-installed backside hanging slot for easy hanging and a non-ticking design.

  • 2 sizes: 20.32 cm diameter or 27.3 cm diameter
  • Material: Grade-A acrylic
  • One AA battery required (not included)
  • Add photos, artwork, and text
  • Indoor use only, not recommended for outdoor use
California Residents: Prop 65 Disclaimer
WarningWARNING: This product can expose you to chemicals including lead, which is known to the State of California to cause cancer and birth defects or other reproductive harm. For more information, go to www.P65Warnings.ca.gov.

About This Design

Viking Pattern Blue Large Clock

Viking Pattern Blue Large Clock

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating3.6K Total Reviews
2968 total 5-star reviews395 total 4-star reviews81 total 3-star reviews42 total 2-star reviews66 total 1-star reviews
3,552 Reviews
Reviews for similar products
5 out of 5 stars rating
By Cassie B.21 December 2018Verified Purchase
Wall Clock, 27.3 cm Round Acrylic
Zazzle Reviewer Program
Our first wedding anniversary is coming up and we heard the modern 1st wedding anniversary gift is clocks. So we decided to get a personalised clock made up to commemorate the occasion. And we're very impressed with the product that we received :-). Looks the exact same way it did online
5 out of 5 stars rating
By W.12 March 2021Verified Purchase
Wall Clock, 27.3 cm Round Acrylic
Zazzle Reviewer Program
I’ve bought a few faux canvas products and I love them all! I bought the baseball clock for my husband who is in permanent aged care. It looks great in his room. The printing look just like the it did in the pic - GREAT!
5 out of 5 stars rating
By J.7 July 2019Verified Purchase
Wall Clock, 27.3 cm Round Acrylic
Zazzle Reviewer Program
I was extremely impressed with the quality of the clock, made of thick durable acrylic. It was packaged securely for overseas shipping and arrived in 7 business days which was fantastic. The design and printing turned out perfectly and as described and we couldn't be happier and would highly recommend Zazzle and its products to everyone.

Tags

Wall Clocks
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256435204405317048
Added on 18/11/17, 11:36 am
Rating: G