Tap / click on image to see more RealViewsTM
$54.85
per flask
 

Viking Pattern Blue Hip Flask

Qty:
177 ml

Other designs from this category

About Flask

Sold by

Size: Vinyl Wrapped Flask, 177 ml

Be prepared and discreet with a custom Liquid Courage™ flask. A unique gift that's perfect for weddings, birthdays, and special occasions!

  • Dimensions: 9.5 cm (L) x 11.4 cm (W) x 2.5 cm (D); 177 ml
  • Material: Stainless steel flask with attached screw-top lid
  • Printed on high-quality vinyl that is securely wrapped
  • Durable, water and fade resistant
  • Hand wash with warm water
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid
Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 9.4 cm x 21.1 cm. For best results, please add 1.1 cm bleed.

About This Design

Viking Pattern Blue Hip Flask

Viking Pattern Blue Hip Flask

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating394 Total Reviews
337 total 5-star reviews46 total 4-star reviews5 total 3-star reviews3 total 2-star reviews3 total 1-star reviews
394 Reviews
Reviews for similar products
1 out of 5 stars rating
By Samantha W.27 June 2024Verified Purchase
Vinyl Wrapped Flask
The flask itself is fine. It’s a cheap flask, obviously bought in bulk, however am prepared to overlook that. Given that it is a personalized item, I would have liked to have seen gift boxing instead of the generic packaging. Terrible printing, and/or quality. It’s a cheap, tacky vinyl. It is not cut straight and is also applied in a way that it is overhanging the bottom, causing the glue to catch on items and it will eventually roll and tear, damaging the wrap. Will not be using this as the intended anniversary present it was bought for.
5 out of 5 stars rating
By Tam D.1 September 2020Verified Purchase
Vinyl Wrapped Flask
Zazzle Reviewer Program
Truly happy with flask Great colours and design Handy take anywhere. Really good happy with result Thanks Zazzle
5 out of 5 stars rating
By K.19 November 2020Verified Purchase
Zazzle Reviewer Program
So happy with this product. Brought it for a Christmas gift for my brother. Very good quality. Thanks. Image on the product is very clear.
Original product

Tags

Flask
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256200989444562947
Added on 18/11/17, 12:57 pm
Rating: G