Tap / click on image to see more RealViewsTM
$1.64  per flyer
$41.00 Subtotal
 

Viking Pattern Blue Flyer

Qty:
Thin Matte Paper
-$0.09

Other designs from this category

About Flyers

Sold by

Size: 21.6 cm x 27.9 cm (8.5" x 11")

Make your promotional materials stand out with a custom flyer. The perfect size for all of your promotional needs, you can upload your own photos, graphics, and logos to craft the perfect flyers for your event, party, or grand opening.

  • Dimensions: 8.5" L x 11" W
  • Larger than quarter-page size
  • High quality, full-color, full-bleed printing
  • Customize both sides at no extra cost
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 8.5" x 11". For best results please add 1/16" bleed

About This Design

Viking Pattern Blue Flyer

Viking Pattern Blue Flyer

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating864 Total Reviews
716 total 5-star reviews88 total 4-star reviews24 total 3-star reviews9 total 2-star reviews27 total 1-star reviews
864 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jamee-Leigh M.13 November 2022Verified Purchase
Flyer Paper, Size: 21.6 cm x 27.9 cm (8.5" x 11"), Paper: Thin Matte Paper
Zazzle Reviewer Program
This product was better than I ever thought, it came out beautifully and has helped make my business flourish and look more professional. It has been so helpful. I love it! Amazing! Very glossy I loved it
3 out of 5 stars rating
By N.3 April 2024Verified Purchase
Flyer Paper, Size: 11.4 cm x 14.2 cm (4.5" x 5.6"), Paper: Basic Semi-Gloss
I had high hopes for this product as I have previously ordered business cards from Zazzle and have been very happy. Unfortunately my hopes were dashed when they arrived today. On the back of each flyer is my business logo which is quite large and the logo has been cut off. This can be seen through the front of the flyer even when right up against the wall. I had no idea this would be printed on the reverse side (I didn't see it anywhere on the order) and it's not pleasant to be seen through the page. Image quality wasn't too bad, however the picture of the poodle at the beach, the color is more mauve on the original file as it was dawn. The color on the printed product here looks more blue.
5 out of 5 stars rating
By Rosangela M.16 July 2019Verified Purchase
Flyer Paper, Size: 21.6 cm x 27.9 cm (8.5" x 11"), Paper: Thin Glossy Paper
Zazzle Reviewer Program
In such difficult moments zazzle over did themselves. As I was looking for my grandpas funeral arrangements I came across this product and thought it would be perfect. The funeral home sells stationary for $200 and zazzle gave me a great product for much less. Highly recommend. Just as I wrote it in the computer
from zazzle.com (US)

Tags

Flyers
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 244564746715675103
Added on 20/11/17, 11:48 am
Rating: G