Tap / click on image to see more RealViewsTM
$1.64  per flyer
$41.00 Subtotal
 

Viking Pattern Blue Flyer

Qty:
  1. Size

  2. Paper Type

Other designs from this category

About Flyers

Sold by

Size: 21.6 cm x 27.9 cm (8.5" x 11")

Make your promotional materials stand out with a custom flyer. The perfect size for all of your promotional needs, you can upload your own photos, graphics, and logos to craft the perfect flyers for your event, party, or grand opening.

  • Dimensions: 8.5" L x 11" W
  • Larger than quarter-page size
  • High quality, full-color, full-bleed printing
  • Customize both sides at no extra cost
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 8.5" x 11". For best results please add 1/16" bleed

About This Design

Viking Pattern Blue Flyer

Viking Pattern Blue Flyer

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.6 out of 5 stars rating898 Total Reviews
732 total 5-star reviews92 total 4-star reviews26 total 3-star reviews11 total 2-star reviews37 total 1-star reviews
898 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Merrick J.13 November 2022Verified Purchase
Flyer Paper, Size: 21.6 cm x 27.9 cm (8.5" x 11"), Paper: Matte
Zazzle Reviewer Program
This product was better than I ever thought, it came out beautifully and has helped make my business flourish and look more professional. It has been so helpful. I love it! Amazing! Very glossy I loved it
3.0 out of 5 stars rating
3 out of 5 stars rating
By N.3 April 2024Verified Purchase
Flyer Paper, Size: 11.4 cm x 14.2 cm (4.5" x 5.6"), Paper: Basic Semi-Gloss
I had high hopes for this product as I have previously ordered business cards from Zazzle and have been very happy. Unfortunately my hopes were dashed when they arrived today. On the back of each flyer is my business logo which is quite large and the logo has been cut off. This can be seen through the front of the flyer even when right up against the wall. I had no idea this would be printed on the reverse side (I didn't see it anywhere on the order) and it's not pleasant to be seen through the page. Image quality wasn't too bad, however the picture of the poodle at the beach, the color is more mauve on the original file as it was dawn. The color on the printed product here looks more blue.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Amelia D.1 June 2026Verified Purchase
Flyer Paper, Size: 21.6 cm x 27.9 cm (8.5" x 11"), Paper: Glossy
Verrryyyyy Adorable! I absolutely love them. Although, I’m an early bird when it comes to important celebrations, like my 50th birthday. It is way in November but of course I opened them and I must say I’m very impressed and so glad I got them ! Thank you lots : ) .
from zazzle.com (US)

Tags

Flyers
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 244564746715675103
Added on 20/11/17, 11:48 am
Rating: G