Tap / click on image to see more RealViewsTM
$114.00
per fleece blanket
 

Viking Pattern Blue Fleece Blanket

Qty:

Other designs from this category

About Fleece Blankets

Sold by

Size: Fleece Blanket, 127 cm x 154.2 cm (50 in x 60 in)

It’s hard to cuddle by yourself. But with these fully customisable comfy fleece blankets, you won’t have to anymore. Customise the entire front panel and wrap yourself in personalised plush luxury. Delicate, soft and colourful, it's the perfect blanket for picnics in the park, outdoor events, and cozy winter snuggles.

  • Available in 3 different sizes: small (76.2 cm x 101.6 cm); medium(127 cm x 152.4 cm); large(152.4 cm x 203.2 cm).
  • 100% buttery soft and cozy polyester fleece
  • Edge-to-edge sublimation printing in vibrant full colour
  • Sturdy double edge stitching for a clean finish
  • Back colour is off-white
  • Machine washable, gentle cycle, mild detergent
  • Tumble dry low
This product is recommended for ages 2+

About This Design

Viking Pattern Blue Fleece Blanket

Viking Pattern Blue Fleece Blanket

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating3.6K Total Reviews
3079 total 5-star reviews342 total 4-star reviews71 total 3-star reviews49 total 2-star reviews31 total 1-star reviews
3,572 Reviews
Reviews for similar products
5 out of 5 stars rating
By Beverley G.9 December 2021Verified Purchase
Fleece Blanket, Medium 127 cm x 152.4 cm
Zazzle Reviewer Program
I ordered a blanket for my daughters 40th birthday. I live in the UK and she lives in Australia. The first blanket didn't arrive so Zazzle arranged a special delivery of another one. My daughter received the blanket on her birthday and absolutely loved it. Thank you Zazzle. I haven't seen the product but I'm told everything was good... printing, quality etc
4 out of 5 stars rating
By Jade T.6 May 2022Verified Purchase
Fleece Blanket, Medium 127 cm x 152.4 cm
Zazzle Reviewer Program
The product is printed correctly, but there's white gaps where the fibres are showing the base colour. There's only 1 or 2mm of colour. If I made it again, I'd make it on a black blanket. The reason it's white underneath, is because I forgot to change it back. It was too hard to see the picture alignment wihtout it. The software is clunky and not intuitive to use. I'm not a graphic designer, so I'm not used to photoshop and the like, so a lot of the settings, although I've seen them on my friend's computer, didn't make much sense to me. Would I make another? Possibly. This one is for me, but I'm not sure about making it available as a product for my fans. It goes all the way to the edges, but not all the way through the fibres. Goodness help you if you can't match the colour of your background, because it will show through the image.
5 out of 5 stars rating
By Elaine H.20 December 2020Verified Purchase
Fleece Blanket, Medium 127 cm x 152.4 cm
Zazzle Reviewer Program
I think this is a lovely layout and was very happy with the result! The prints are beautiful and I'm sure my family will LOVE!

Tags

Fleece Blankets
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256478076938277373
Added on 18/11/17, 12:45 pm
Rating: G