Tap / click on image to see more RealViewsTM
$113.00
per fleece blanket
 

Viking Pattern Blue Fleece Blanket

Qty:
  1. Size

Other designs from this category

About Fleece Blankets

Sold by

Size: Fleece Blanket, 127 cm x 154.2 cm (50 in x 60 in)

It’s hard to cuddle by yourself. But with these fully customisable comfy fleece blankets, you won’t have to anymore. Customise the entire front panel and wrap yourself in personalised plush luxury. Delicate, soft and colourful, it's the perfect blanket for picnics in the park, outdoor events, and cozy winter snuggles.

  • Available in 3 different sizes: small (76.2 cm x 101.6 cm); medium(127 cm x 152.4 cm); large(152.4 cm x 203.2 cm).
  • 100% buttery soft and cozy polyester fleece
  • Edge-to-edge sublimation printing in vibrant full colour
  • Sturdy double edge stitching for a clean finish
  • Back colour is off-white
  • Machine washable, gentle cycle, mild detergent
  • Tumble dry low
This product is recommended for ages 2+

About This Design

Viking Pattern Blue Fleece Blanket

Viking Pattern Blue Fleece Blanket

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating3.6K Total Reviews
3117 total 5-star reviews344 total 4-star reviews72 total 3-star reviews52 total 2-star reviews35 total 1-star reviews
3,620 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Beverley G.9 December 2021Verified Purchase
Fleece Blanket, 127 cm x 152.4 cm
Zazzle Reviewer Program
I ordered a blanket for my daughters 40th birthday. I live in the UK and she lives in Australia. The first blanket didn't arrive so Zazzle arranged a special delivery of another one. My daughter received the blanket on her birthday and absolutely loved it. Thank you Zazzle. I haven't seen the product but I'm told everything was good... printing, quality etc
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kelly14 January 2022Verified Purchase
Fleece Blanket, 76.2 cm x 101.6 cm
Zazzle Reviewer Program
Worked out perfectly, it brings back the perfect memories that I was hoping for. Absolutely love this product. Printing worked out great.
5.0 out of 5 stars rating
5 out of 5 stars rating
By D.30 November 2022Verified Purchase
Fleece Blanket, 127 cm x 152.4 cm
Zazzle Reviewer Program
Did not receive product and messaged the company, they were amazing. Express posted another one. That was great communication and not hard to deal with the company. Great Quality, clear print and blanket was soft and beautiful quality

Tags

Fleece Blankets
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256478076938277373
Added on 18/11/17, 12:45 pm
Rating: G