Tap / click on image to see more RealViewsTM
$38.35
per ornament
 

Viking Pattern Blue Ceramic Ornament

Qty:
Ceramic Heart Ornament
-$6.20
-$6.20
-$6.20
-$8.25
-$8.25
-$8.25
-$2.05
-$2.05
-$2.05
+$10.35
+$10.35

Other designs from this category

About Ornaments

Sold by

Style: Ceramic Heart Ornament

Bring a lot more holiday cheer to your tree with a custom ceramic tree decoration. Add family photos, images and personal message to both sides of this tree decoration. A strand of gold thread makes it easy to hang this fantastic keepsake.

  • Dimensions: 7.6 cm l x 7.1 cm w; Weight: 39 g.
  • Made of white porcelain
  • Full-colour, full-bleed printing
  • Printing on both sides
  • Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 7.6 cm x 7.1 cm. For best results please add 0.3 cm (1/8") bleed.

About This Design

Viking Pattern Blue Ceramic Ornament

Viking Pattern Blue Ceramic Ornament

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating11.7K Total Reviews
9530 total 5-star reviews1288 total 4-star reviews373 total 3-star reviews177 total 2-star reviews290 total 1-star reviews
11,658 Reviews
Reviews for similar products
5 out of 5 stars rating
By Shirley J.18 April 2022Verified Purchase
Ceramic Heart Ornament
Zazzle Reviewer Program
Absolutely thrilled with how it's turned out. After having bought several for Gold Wedding Anniversaries, wasn't sure how this would look, but I'm delighted. I hope the couple are when they receive it. I had forgotten how prompt Zazzle can be so it's a tad early. Wonderful. Couldn't be more pleased as I wasn't sure how it would look. Very pleased. The artist did well. 👏👏👏
5 out of 5 stars rating
By Kylie H.24 December 2021Verified Purchase
Ceramic Oval Ornament
Zazzle Reviewer Program
I bought this for my dog when he first joined me for Christmas. This year I bought a second one for my new dog so they would both have one. It came in a timely manner even though it had to cross the sea to Australia. I would recommend it to anyone who wants a personalised ornament for there dog. It’s quality was perfect for what I was expecting.
5 out of 5 stars rating
By Shirley J.17 April 2022Verified Purchase
Ceramic Heart Ornament
Zazzle Reviewer Program
I was as thrilled with this one, which is for my Son and Daughter-in-law, as I was with the ones I purchased previously. for some gold Wedding Anniversaries. I hope they will be as delighted as I am. Forgetting how prompt Zazzle are it's a tad early. Definately recommend the artist as well. So pleased.👏👏👏. Turned out perfectly. Very happy.

Tags

Ornaments
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 175880270232656110
Added on 18/11/17, 12:03 pm
Rating: G