Tap / click on image to see more RealViewsTM
$21.90
each
 

Viking Pattern Blue Ceramic Knob

Qty:
Ceramic Knob

Other designs from this category

About Ceramic Pulls

Sold by

Style: Ceramic Knob

Spruce up cabinets and furniture and take your decorating game to the next level by customising your own knobs. From the kitchen to your child’s bedroom, custom knobs are the perfect accent that can complement any décor.

  • Beautiful 3.8 cm wide white ceramic knobs.
  • Standard size; fits most 3.2 cm diameter holes.
  • Easy installation.
  • Includes screw. No additional hardware required.
  • Great for cabinets, drawers, and furniture.
  • Perfect finishing touch to bedrooms, kitchens, DIY projects and more!
  • This product has small parts and is not a toy. Not recommended for children 8 and below.

About This Design

Viking Pattern Blue Ceramic Knob

Viking Pattern Blue Ceramic Knob

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating231 Total Reviews
206 total 5-star reviews14 total 4-star reviews2 total 3-star reviews2 total 2-star reviews7 total 1-star reviews
231 Reviews
Reviews for similar products
5 out of 5 stars rating
By Emma M.3 October 2025Verified Purchase
Ceramic Knob
Lovely item- all very consistent in quality. I ordered 50 and they were all excellent quality. Came very quickly too!
5 out of 5 stars rating
By Julie b.7 June 2025Verified Purchase
Ceramic Knob
Unique perfect thankyou.
4 out of 5 stars rating
By K.9 January 2018Verified Purchase
Ceramic Knob
Zazzle Reviewer Program
Seems good quality and very like the image. Very well. Clear and good colouring

Tags

Ceramic Pulls
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256139192633319931
Added on 18/11/17, 12:54 pm
Rating: G