Tap / click on image to see more RealViewsTM
$21.60
$10.80 each
 

Viking Pattern Blue Black Ink Pen

Qty:
Black
Black

Other designs from this category

About Pens

Sold by

Writing Ink Colour: Black Ink Pen

Just because we all have smart phones and laptops doesn't mean the written word is on its way out. In fact, it means just that much more to receive a personal handwritten note! Arm yourself with your own writing mechanism by customising your own one-of-a-kind pen, and continue to make statements in the good ol' fashioned way.

  • Minimum order of 2.
  • Click into action with your own one-of-a-kind pen.
  • Available in multiple colour inks & trim accents.
  • Printed in full vibrant colour that is sure to wow.
  • Extended life writing cartridges.
  • Proudly made in the USA.
  • Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 10.2 cm x 3.4 cm. For best results please add 0.6 cm bleed.

About This Design

Viking Pattern Blue Black Ink Pen

Viking Pattern Blue Black Ink Pen

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating478 Total Reviews
408 total 5-star reviews48 total 4-star reviews10 total 3-star reviews6 total 2-star reviews6 total 1-star reviews
478 Reviews
Reviews for similar products
5 out of 5 stars rating
By S.18 September 2021Verified Purchase
Black Trim Pen, Black Ink
Zazzle Reviewer Program
Love using for study, it writes so smooth. Love the style I chose . Printed pretty clear
5 out of 5 stars rating
By A.3 January 2024Verified Purchase
Black Trim Pen, Black Ink
Zazzle Reviewer Program
Very cute and much loved by the recipient at Christmas time. Printing was very clear and cute to look at
5 out of 5 stars rating
By T.30 December 2022Verified Purchase
Black Trim Pen, Black Ink
Zazzle Reviewer Program
The pens turned out just like the picture. Everything was great.

Tags

Pens
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256923905525289734
Added on 20/11/17, 11:38 am
Rating: G