Tap / click on image to see more RealViewsTM
$98.85
per banner
 

Viking Pattern Blue Banner

Qty:
91cm x 152cm

Other designs from this category

About Banners

Sold by

Size: 91cm x 152cm Banner

Shout it from the rooftops, say it big and bold - it's time to get the word out! Indoors or out, our banners are here to help you advertise anything, from birthdays to graduation, weddings to anniversaries. We've got thousands of designs for you to browse through, along with 4 different size options.

  • Dimensions: 0.9 m l x 1.5 m w (horizontal) or 1.5 m l x 0.9 m w (vertical)
  • Edge-to-edge, full colour vibrant print for a bold statement
  • Hemmed and thermally welded edges for neat finish
  • Choice of indoor or outdoor banners. Outdoor banners can be bought with metal grommets

Material: Indoor

Lightweight and durable, our 368 g (13 oz) vinyl material is best suited for indoor or short-term outdoor events. This white flexible material comes with an elegant matte finish, and is both fade and tear resistant.

About This Design

Viking Pattern Blue Banner

Viking Pattern Blue Banner

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.9 out of 5 stars rating2.3K Total Reviews
2088 total 5-star reviews88 total 4-star reviews30 total 3-star reviews13 total 2-star reviews37 total 1-star reviews
2,256 Reviews
Reviews for similar products
5 out of 5 stars rating
By E.10 September 2022Verified Purchase
Vinyl Banner, 91cm x 152cm, Indoor
Zazzle Reviewer Program
I was very impressed with my purchase of the First Holy Communion Banner for my girls, got here in plenty of time. Was able to surprise the whole family with the product and others were asking where i purchased it from so thanks heaps Zazzle for a fantastic job. Recommend Zazzle and their products :). The image and over all banner had excellent quality was very happy with the end results. Totally recommend Zazzle products.
5 out of 5 stars rating
By M.19 May 2021Verified Purchase
Vinyl Banner, 91cm x 152cm, Indoor
Zazzle Reviewer Program
The poster is amazing quality. Images came out great! The texture is very strong and durable. This will last a lifetime. I ordered this as a surprise for my friends 30th birthday and I can tell already she is going to love it as much as I do! Easy service. Easy transaction. Fast delivery from USA to Australia!! Thank you x Thanks so much. The colours were vibrant, images were perfect! Thanks!
5 out of 5 stars rating
By L.21 May 2023Verified Purchase
Vinyl Banner, 76cm x 183cm, Indoor
Zazzle Reviewer Program
For the.price of this banner I didn't expect top quality but was I wrong. The vinyl is thick and very strong as are the gromets. Very well stitched and came exactly how I ordered it. I couldn't believe I got a top quality banner that cheap. 100% satisfied The photo quality came out exactly how I sent them and the print was exactly how it showed on the order

Tags

Banners
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256325634972916561
Added on 20/11/17, 11:22 am
Rating: G