Tap / click on image to see more RealViewsTM
$4.89
per card
 

Viking Pattern Blue

Qty:
Squared
+$0.35
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$1.00
+$1.00
-$0.30

About Flat Cards

Sold by

Size: 8.9 cm x 12.7 cm

Stand out with custom flat cards, turn this flat card into anything imaginable.

  • Dimensions: 8.89 cm x 12.7 cm (portrait or landscape)
  • High-quality, full-colour, full-bleed printing
  • Print on both sides for no additional cost
  • Add personal photos and text for free

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Viking Pattern Blue

Viking Pattern Blue

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating2.4K Total Reviews
2096 total 5-star reviews157 total 4-star reviews40 total 3-star reviews29 total 2-star reviews82 total 1-star reviews
2,404 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous6 July 2025Verified Purchase
Flat Card, Size: 10.2 cm x 22.9 cm, Paper: Basic Semi-Gloss, Corner: Squared
Arrived 3days early lv personalized option, a nice gift with flight tickets. Happy with this purchase .
5.0 out of 5 stars rating
5 out of 5 stars rating
By maggie f.16 April 2024Verified Purchase
Flat Card, Size: 8.9 cm x 12.7 cm, Paper: Signature Matte, Corner: Squared
Excellent quality. Excellent presentation, the perfect professional representation of my store. Together with my business cards that customers comment on regularly, I would highly recommend. Excellent as I hoped and better
5.0 out of 5 stars rating
5 out of 5 stars rating
By T.31 July 2022Verified Purchase
Flat Card, Size: 10.8 cm x 14 cm, Paper: Signature Matte, Corner: Squared
Zazzle Reviewer Program
My cards were printed and posted quickly and arrived exactly how I wanted them. Very good quality and easy to customise - with lots of options! Print quality was extremely good quality. It’s important to use a high-quality photo especially when expanding the image.

Tags

Flat Cards
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256091188921896013
Added on 17/11/17, 10:18 pm
Rating: G