Tap / click on image to see more RealViewsTM
$7.05
per card
 

Viking Pattern Blue

Qty:
Choose Your Format
Signature Matte
  • 17 pt thickness / 120 lb weight
  • Light white, uncoated matte finish with an eggshell texture
+$1.00
+$1.00
-$0.30

About Cards

Sold by

Size: Standard (12.7 cm x 17.8 cm)

Birthdays or holidays, good days or hard days, Zazzle’s Customised greeting cards are the perfect way to convey your wishes on any occasion. Add a photo or pick a design and brighten someone’s day with a simple “hi”!

  • Dimensions: 12.7 cm x 17.8 cm (portrait) or 17.8 cm x 12.7 cm (landscape)
  • Full colour CMYK print process
  • All-sided printing for no additional cost
  • Printable area on the back of the card is 7.62 cm x 10.16 cm (portrait) or 10.16 cm x 7.62 cm (landscape)
  • Blank white envelopes included

Paper Type: Matte

The most popular paper choice, Matte’s eggshell texture is soft to the touch with a smooth finish that provides the perfect backdrop for your chosen designs.

  • Light white, uncoated matte finish with an eggshell texture
  • Paper is easy to write on and won't smudge

About This Design

Viking Pattern Blue

Viking Pattern Blue

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.9 out of 5 stars rating7.4K Total Reviews
6765 total 5-star reviews494 total 4-star reviews71 total 3-star reviews27 total 2-star reviews35 total 1-star reviews
7,392 Reviews
Reviews for similar products
5 out of 5 stars rating
By E.15 November 2021Verified Purchase
Folded Card, Size: Standard (12.7 cm x 17.8 cm), Paper: Signature Matte
Zazzle Reviewer Program
Lovely quality cards. Nice to get a real traditional Chrismassy theme in Australia, not the beach and Australian animals stuff. Excellent, would use again
5 out of 5 stars rating
By Angela M.16 November 2022Verified Purchase
Folded Card, Size: Big (21.6 cm x 28 cm), Paper: Signature Matte
Zazzle Reviewer Program
Easy to order Good price Quick delivery. Card came out exactly as ordered
5 out of 5 stars rating
By Nicole B.20 August 2025Verified Purchase
Folded Card, Size: Small (10.2 cm x 14.2 cm), Paper: Signature Matte
Very impressed with the quality of my personalised birthday card. Also received it very quickly .

Tags

Cards
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 137887351179637802
Added on 19/11/17, 10:04 am
Rating: G