Tap / click on image to see more RealViewsTM
$125.00
per pair of leggings
 

Tropical Parrot Birds All Over Print Leggings

Qty:

Other designs from this category

About Leggings

Sold by

Style: Leggings

Style and comfort make these the perfect pair of leggings. Custom-made with care; each pair is printed before being sewn, allowing for fun designs on every square inch. These leggings won't lose their shape so get comfy and look cool with your own unique pair.

Due to the cut-and-sew nature of each pair of leggings, designs, and prints may not match up at the seams. We do not recommend designs with words printed on or across the seam as they are hard to match precisely by even the most skilled of dressmakers.

Size & Fit

  • Full length leggings
  • Model is 5'10" (178 cm) and wearing a size S
  • Compression fit due to high spandex content; our leggings hug in all the right places and suit all body types

Fabric & Care

  • Material: Ultra-stretch polyester spandex blend. Legging is 79% polyester, 21% spandex. Capri is 88% polyester, 12% spandex
  • Sturdy, breathable, and stretches to fit your body
  • High spandex composition means compression fit won't lose shape; hugs in all the right places and bounces back after washing
  • Machine wash cold, gentle cycle. Or hand wash. Tumble dry medium heat. Do not bleach
  • Vibrant print won't fade after washing
  • Hand sewn in Canada

About This Design

Tropical Parrot Birds All Over Print Leggings

Tropical Parrot Birds All Over Print Leggings

Awesome collage of vintage botanical fine art of exotic tropical Parrot Birds and habitat Pods, etc., is on these great All Over Print Leggings. Image is public domain due to expired copyright.

Customer Reviews

4.8 out of 5 stars rating845 Total Reviews
730 total 5-star reviews86 total 4-star reviews14 total 3-star reviews8 total 2-star reviews7 total 1-star reviews
845 Reviews
Reviews for similar products
5 out of 5 stars rating
By Joshua C.7 January 2023Verified Purchase
All-Over-Print Leggings, XS
Creator Review
Happy with the reliable delivery and even happier with my leggings! The colours are really vivid and fun for summer. - nice original look I've already had quite a few comments about them. Great printing quality on a well made stretch fabric, it looks just as colourful in real life, great job!
5 out of 5 stars rating
By Sharon C.31 March 2021Verified Purchase
All-Over-Print Leggings, XS
Creator Review
I am really pleased to say that the fabric used in these leggings has been very good. I have warn them regularly and have put them through many washes over many months and they are as good as when I first got them. I would definitely recommend this product. The printing and colours were exactly as the on-purchase pictured item and are fantastic at hiding marks from dog paws etc. A very practical colour scheme and pattern.
5 out of 5 stars rating
By S.5 November 2017Verified Purchase
All-Over-Print Leggings, M
Zazzle Reviewer Program
Seriously comfortable leggings! The design is what really got me - Very abstract and bold! So vibrant! Exactly what it looked like online which was great! The size guide provided was incredibly accurate. Shipping to Australia was so much quicker than I had expected (two weeks!) I'm so happy with the overall product. They will be worn to death ☺. The colours were amazing! So vibrant and exactly how it looked online. I've washed the leggings quite a few times now and they have not faded at all! So happy!

Tags

Leggings
leggingsall over printbirdswildlifeanimalsvintageparrotstropicalexotic birds
All Products
leggingsall over printbirdswildlifeanimalsvintageparrotstropicalexotic birds

Other Info

Product ID: 256579313708620942
Added on 3/12/16, 6:47 pm
Rating: G