Tap / click on image to see more RealViewsTM
$241.00
per skateboard
 

The Hero Skateboard

Qty:
  1. Deck Type

  2. Complete Your Board

Other designs from this category

About Skateboards

Sold by

Deck Type: 21.59 cm Skateboard Deck

If you're a passionate skateboarder, or if you have one at home and are searching for great gift ideas, you've come to the right place! Our skateboards are of fantastic quality, available in a variety of sizes, and are perfect for both beginners and pros alike. By adding your own design, you can create a unique deck that will definitely catch attention. If you're not feeling creative, don't worry - you can simply choose your favourite design from our selection crafted by our talented Independent Designers.

  • Professional quality skateboard deck made from the highest quality materials
  • Seven plies of premium USA Maple from the Great Lakes region
  • Skateboard-specific glue from Franklin.

Complete Your Board: Trucks and Wheels

Add some awesome trucks and wheels to the mix, and you’ll have the skateboard of your dreams! You’ll be able to start coasting down those ramps on your new board right away!

  • Note: Truck & Wheel Size varies by board
  • Truck width: 5.25
  • All terrain skateboard trucks
  • Hanger and baseplate made of high quality aluminium with spring steel axles.
  • Classic polyurethane wheel formula for street, park, and all-around skateboarding. 99A hardness.
  • Wheel Size (mm): 52
WarningWARNING: This product can expose you to chemicals including Lead, which are known to the State of California to cause cancer and birth defects or other reproductive harm. For more information, go to www.P65Warnings.ca.gov.

About This Design

The Hero  Skateboard

The Hero Skateboard

Public Domain Comic Book Heroes.

Customer Reviews

4.8 out of 5 stars rating174 Total Reviews
150 total 5-star reviews16 total 4-star reviews2 total 3-star reviews2 total 2-star reviews4 total 1-star reviews
174 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By T s.26 April 2023 • Verified Purchase
20.63 cm Skateboard Deck
Zazzle Reviewer Program
So happy with the end product. Just as described and turn around time was super quick. Received it earlier than expected. Amazing print quality.
5.0 out of 5 stars rating
5 out of 5 stars rating
By A.23 August 2022 • Verified Purchase
19.68 cm Skateboard Deck
Zazzle Reviewer Program
This turned out great!
5.0 out of 5 stars rating
5 out of 5 stars rating
By William G.16 August 2012 • Verified Purchase
21.59 cm Skateboard Deck
Zazzle Reviewer Program
the board itself is made in Mexico, which is pretty cool, and the quality of the print is superb, very detailed and became a focal point in my living room. The colors are best than i expected

Tags

skateboardtricksflipsrampgrindingvirtualwheelssportsstreet

Other Info

Product ID: 256080957484048847
Added on 8/9/25, 4:13 pm
Rating: G