Tap / click on image to see more RealViewsTM
$29.55
per tile
 

The Griffin's Plume Ceramic Tile

Qty:
  1. Size

Frame and Keepsake Boxes available
Starting from $7.85
Select your accessory options after adding to cart

Other designs from this category

About Tiles

Sold by

Size: 15.24 cm x 15.24 cm

Display your favorite photos, images, and quotes on this vibrant ceramic tile. You can use your custom tile as a trivet or to upgrade your home décor. Great for holiday, wedding, and office gifts.

  • Dimensions: 15.24cm L x 15.24cm W; Thickness: 0.5cm
  • Weight: 241g.
  • Made of white ceramic
  • Full-color, full-bleed printing
  • Intended for residential use. Suitable for dry or low-moisture indoor wall applications with brief exposure to water (such as backsplashes which are properly sealed and grouted). Not suitable for use on floors. Not suitable for constantly wet areas (like showers). Protect from exposure to direct sunlight. Not frost resistant.
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 15.24cm x 15.24cm. For best results please add 0.3cm bleed

About This Design

The Griffin's Plume Ceramic Tile

The Griffin's Plume Ceramic Tile

Close-up shot of an ornate, decorative tile design. The design features a central, fan-like motif with alternating sections of light purple and light orange. This fan is framed by a green border that curves around the top and sides, with decorative swirls at the bottom corners. The border is further embellished with gold accents, particularly at the top and bottom.

Customer Reviews

4.8 out of 5 stars rating1.1K Total Reviews
975 total 5-star reviews61 total 4-star reviews19 total 3-star reviews11 total 2-star reviews11 total 1-star reviews
1,077 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Tania22 December 2019Verified Purchase
Ceramic Tile, 10.80 cm x 10.80 cm
Zazzle Reviewer Program
The quality of the image was absolutely superb I really love the way I could choose background font and colours. The printing was amazing it looks just like the photo
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous28 July 2025Verified Purchase
Ceramic Tile, 15.24 cm x 15.24 cm
Absolutely love this tile looks fabulous on my letter box. So very happy with the quality and the shipping. Would recommend this product to anyone. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Michele P.28 March 2022Verified Purchase
Ceramic Tile, 10.80 cm x 10.80 cm
Zazzle Reviewer Program
Very happy when my tiles arrived. So good to be able to choose any photo for personal use. The colours are very clear and are far better than I expected.

Tags

Tiles
artdecoplumeshellpinkgreenwhitevintageceramictile
All Products
artdecoplumeshellpinkgreenwhitevintageceramictile

Other Info

Product ID: 256697075007500530
Added on 10/10/25, 10:49 pm
Rating: G