Tap / click on image to see more RealViewsTM
Sale Price $4.37.  
Original Price $6.24 per card
You save 30% ends today

Thank You for Help Vintage Girl & Cat

Qty:
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$1.10
+$1.10
-$0.30
Vertical

Other designs from this category

About Folded Thank You Cards

Sold by

Size: Standard, 12.7 cm x 17.8 cm

Be obsessively grateful! Custom thank you cards for small things, big things, and everything in between.

  • Dimensions: 12.7 cm x 17.78 cm (portrait or landscape)
  • Full colour CMYK print process
  • Double-sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Thank You for Help Vintage Girl & Cat

Thank You for Help Vintage Girl & Cat

This sweet illustration of a girl feeding her cat is the perfect way to say thank you for your help. Image is from Graphics Fairy and is in the public domain. Public-Domain-Download-Girl-Cat-GraphicsFairy

Customer Reviews

4.8 out of 5 stars rating3.7K Total Reviews
3297 total 5-star reviews251 total 4-star reviews48 total 3-star reviews26 total 2-star reviews34 total 1-star reviews
3,656 Reviews
Reviews for similar products
5 out of 5 stars rating
By MrsTarita B.28 February 2022Verified Purchase
Folded Thank You Card, Size: Small, 10.2 cm x 14.2 cm, Paper: Signature Matte
Zazzle Reviewer Program
Absolutely beautiful I love it. Absolutely perfect 🥰
5 out of 5 stars rating
By Sharon C.9 July 2020Verified Purchase
Folded Thank You Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte
Creator Review
The print quality was very good. I used the gloss stock and was happy with the result. The stock is heavy and may need to be well creased or pressed to keep it sitting flat when folded. The design does make you smile. Colours of the printing were accurate to the photo on the internet. The sharpness and quality of printing was excellent.
5 out of 5 stars rating
By DESIREE H.25 August 2024Verified Purchase
Folded Thank You Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte
Adapted this semi-gloss Thank you card for our soccer team's Team manager - he though it was Awesome and enough space for short messages from the boys. Thank you!

Tags

Folded Thank You Cards
thankyouhelpvintagegirlcatfeedingmilksaucerbowl
All Products
thankyouhelpvintagegirlcatfeedingmilksaucerbowl

Other Info

Product ID: 137663167239947182
Added on 19/5/15, 5:48 am
Rating: G