Tap / click on image to see more RealViewsTM
$4.36
per sticker
 

Tarantula Police Bear - Spiky Accessories & Cute

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Tiny 5 cm x 5 cm

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 5.08 cm L x 6.35 cm H
  • Design Area: 5.08 cm L x 5.08 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Tarantula Police Bear - Spiky Accessories & Cute

Tarantula Police Bear - Spiky Accessories & Cute

Cute Bear in Hardcore Police Uniform - Spiky & Shiny Style 🐻🕷️🖤✨ "Get ready for a wild twist! This adorable bear is rocking a shiny, black police uniform with spiky accessories, and a surprising guest - a tarantula! But don't worry, its cute face will win you over. 🐻🖤 This design embodies a unique blend of hardcore style and ultimate dreamy kawaii charm, perfect for fashion lovers, spider enthusiasts, and anyone who adores unique cute art with an edgy, unexpected twist. Fully customizable for any Zazzle product, it makes a perfect gift or a lovely treat for yourself! Let this bold bear make a statement! 💖 This design is fully customizable - add your own text or image to make it uniquely yours!" 🐻🕷️🖤✨ "Mach dich bereit für eine wilde Wendung! Dieser bezaubernde Bär rockt eine glänzende, schwarze Polizeiuniform mit stacheligen Accessoires und einem überraschenden Gast - eine Vogelspinne! Aber keine Sorge, sein süßes Gesicht wird dich überzeugen. 🐻🖤 Dieses Design verkörpert eine einzigartige Mischung aus Hardcore-Stil und ultimativem verträumten Kawaii-Charme, perfekt für Modeliebhaber, Spinnenliebhaber und alle, die einzigartige niedliche Kunst mit einem ausgefallenen, unerwarteten Touch lieben. Vollständig anpassbar für jedes Zazzle-Produkt, ist es ein perfektes Geschenk oder eine nette Belohnung für Sie selbst! Lass diesen mutigen Bären ein Statement setzen! 💖 Dieses Design ist vollständig anpassbar - füge deinen eigenen Text oder dein eigenes Bild hinzu, um es einzigartig zu machen!" 🐻🕷️🖤✨ "Préparez-vous à une tournure sauvage ! Cet adorable ours arbore un uniforme de police noir brillant avec des accessoires pointus, et un invité surprise - une tarentule ! Mais ne vous inquiétez pas, son visage mignon vous séduira. 🐻🖤 Ce design incarne un mélange unique de style hardcore et de charme kawaii onirique ultime, parfait pour les amoureux de la mode, les passionnés d'araignées, et tous ceux qui adorent l'art mignon unique avec une touche audacieuse et inattendue. Entièrement personnalisable pour tout produit Zazzle, c'est un cadeau parfait ou une jolie gâterie pour vous-même ! Laissez cet ours audacieux faire une déclaration ! 💖 Ce design est entièrement personnalisable - ajoutez votre propre texte ou image pour le rendre unique !" 🐻🕷️🖤✨ "Preparati per una svolta selvaggia! Questo adorabile orso sfoggia un uniforme da poliziotto nero lucido con accessori appuntiti e un ospite a sorpresa: una tarantola! Ma non preoccuparti, il suo viso carino ti conquisterà. 🐻🖤 Questo design incarna una miscela unica di stile hardcore e massimo fascino kawaii sognante, perfetto per gli amanti della moda, gli appassionati di ragni e chiunque adori l'arte unica e carina con un tocco audace e inaspettato. Completamente personalizzabile per qualsiasi prodotto Zazzle, è un regalo perfetto o una deliziosa coccola per te stesso! Lascia che questo orso audace faccia una dichiarazione! 💖 Questo design è completamente personalizzabile: aggiungi il tuo testo o la tua immagine per renderlo unico!" 🐻🕷️🖤✨ "Design with wild twist! This lovely Bear-Chan wears shiny black police uniforms, spiny accessories, and even surprise guests - Tarantula! But don't worry. I'm sure I'll be crazy about the cute face. 🐻🖤 This design combines a hardcore style with the ultimate dream kawaii charm, and embodies the unique and unique design. Perfect for everyone who loves fashion, spider, and love the unique and cute art with an edge-enabled twist! You can customize any item in Zazzle, so it's perfect for perfect gifts and a nice reward for yourself! Let's claim your personality with this bold bear! 💖 This design is freely customizable - you can add your text or pictures to make it your only special item! " #PoliceBear, #Tarantula, #SpikyFashion, #KawaiiArt, #HardcoreCute, #UniqueStyle, #DreamyCute, #Yumekawaii, #EdgyArt, #BoldFashion #DreamyPastel, #CelestialArt, #CuteSpace,

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
933 total 5-star reviews66 total 4-star reviews28 total 3-star reviews28 total 2-star reviews88 total 1-star reviews
1,143 Reviews
Reviews for similar products
5 out of 5 stars rating
By C.1 March 2021Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I'm super happy with this beautiful Owl Mandala transfer. It suits my car perfectly. If I could have bought a bigger one, I would've! High-quality printing and materials. I believe the transfer will be relatively weather-resistant. Only time will tell.
5 out of 5 stars rating
By Blake C.12 October 2020Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
To be honest, I wasn't expecting much, as I am using these stickers as a decal for my ute doors. That being said, it is extremely affordable, and to get these done on another website I saw, they wanted to charge me over $100 for smaller. These stickers are amazing quality and well worth the money. By far exceeded my expectations and will do the job nicely. The stick great. The only thing I would change is instead of a cut out of each part, if they'd have the backing, sticker, then clear over the top for easy application because the moment I tore off the front to apply the sticker, the lettering stayed on the backing paper causing me to have to use the front as a boarder/stencil and carefully apply the lettering inside the lines. But either way, I'm very happy. Thank you. The printing was awesome. Top quality and no issues whatsoever. As I stated in the "what I thought about this product" section, The only thing I would change is instead of a cut out of each part, if they'd have the backing paper, sticker, then clear over the top that the front of the sticker sticks to for easy application in one go. Because the moment I tore off the front to apply the sticker, the lettering stayed on the backing paper causing me to have to use the front as a boarder/stencil and carefully apply the lettering inside the lines
4 out of 5 stars rating
By Galit B.28 December 2023Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
The stick looks amazing. Unfortunately, it would not stick on our suitcase as it was textured. When we found a non-textured (smooth) suitcase, the sticker stuck and looks great. The printing looked awesome.

Tags

Custom-Cut Vinyl Stickers
yukatabearpastelhairhydrangeakawaiiartpearlkimonoelegantcutedreamycuteyumekawaiijapanesestylelonghair
All Products
yukatabearpastelhairhydrangeakawaiiartpearlkimonoelegantcutedreamycuteyumekawaiijapanesestylelonghair

Other Info

Product ID: 256020605305376688
Added on 10/6/25, 11:51 am
Rating: G