Tap / click on image to see more RealViewsTM
$64.77
each
 

Symmetric Pink Flower Tiled Pattern on Sage Bath Towel

Qty:
Personalise this template

Other designs from this category

About Towels

Sold by

Style: Bath Towel

Turn your bathroom into your own personal oasis with a custom towel perfect for drying you off in style. Towel set is a great gift for many occasions.

  • Dimensions: 76.2 cm x 152.4 cm
  • Material: front is a polyester blend, back is 100% cotton
  • Sublimation printing allows for vibrant printing designed to last
  • Machine washable, tumble dry on low

About This Design

Symmetric Pink Flower Tiled Pattern on Sage Bath Towel

Symmetric Pink Flower Tiled Pattern on Sage Bath Towel

My design features a beautiful tiled, pink flower motif, within a mosaic frame. This is a repeated, symmetrical pattern placed on a soft sage green, background. Adding a personalised name makes a charming gift idea. This item can be given a personalised name, with the design tool. Change the text and font to a style and colour of your choice.

Customer Reviews

4.5 out of 5 stars rating517 Total Reviews
403 total 5-star reviews48 total 4-star reviews18 total 3-star reviews18 total 2-star reviews30 total 1-star reviews
517 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous3 July 2024Verified Purchase
Bathroom Towel Set
Arrived ahead of schedule. Beautifully made and so lightweight, will dry quickly. Love the design and looks stunning in my bathroom. Thank you. Wonderful design. The print is excellent and the colour combination is exactly what I wanted.
5 out of 5 stars rating
By M.13 November 2023Verified Purchase
Bathroom Towel Set
Zazzle Reviewer Program
Excellent product great water absorbency. Printing lovely and bright
5 out of 5 stars rating
By T.6 September 2019Verified Purchase
Bath Towel
Zazzle Reviewer Program
Website was very user friendly, my order was made very quickly and delivered fast. Quality is fantastic, I am very happy with the product. Great quality. Pictures ate all clear.

Tags

Towels
flowerpatternpinkgreennamesymmetrictilesagemotifmosaic
All Products
flowerpatternpinkgreennamesymmetrictilesagemotifmosaic

Other Info

Product ID: 256053667625050057
Added on 1/2/24, 3:29 am
Rating: G