Tap / click on image to see more RealViewsTM
$64.77
each
 

Symmetric Pink Flower Tiled Pattern on Sage Bath Towel

Qty:

Other designs from this category

About Towels

Sold by

Style: Bath Towel

Turn your bathroom into your own personal oasis with a custom towel perfect for drying you off in style. Towel set is a great gift for many occasions.

  • Dimensions: 76.2 cm x 152.4 cm
  • Material: front is a polyester blend, back is 100% cotton
  • Sublimation printing allows for vibrant printing designed to last
  • Machine washable, tumble dry on low

About This Design

Symmetric Pink Flower Tiled Pattern on Sage Bath Towel

Symmetric Pink Flower Tiled Pattern on Sage Bath Towel

My design features a beautiful tiled, pink flower motif, within a mosaic frame. This is a repeated, symmetrical pattern placed on a soft sage green, background. Adding a personalised name makes a charming gift idea. This item can be given a personalised name, with the design tool. Change the text and font to a style and colour of your choice.

Customer Reviews

4.4 out of 5 stars rating546 Total Reviews
414 total 5-star reviews49 total 4-star reviews20 total 3-star reviews22 total 2-star reviews41 total 1-star reviews
546 Reviews
Reviews for similar products
5 out of 5 stars rating
By Julie C.26 February 2026Verified Purchase
Bath Towel
Love this towel it was brought for my dogs birthday. It was a wonderful design & soft towel as well.🥰🥰.
5 out of 5 stars rating
By Anonymous3 July 2024Verified Purchase
Bathroom Towel Set
Arrived ahead of schedule. Beautifully made and so lightweight, will dry quickly. Love the design and looks stunning in my bathroom. Thank you. Wonderful design. The print is excellent and the colour combination is exactly what I wanted.
5 out of 5 stars rating
By M.13 November 2023Verified Purchase
Bathroom Towel Set
Zazzle Reviewer Program
Excellent product great water absorbency. Printing lovely and bright

Tags

Towels
flowerpatternpinkgreennamesymmetrictilesagemotifmosaic
All Products
flowerpatternpinkgreennamesymmetrictilesagemotifmosaic

Other Info

Product ID: 256053667625050057
Added on 1/2/24, 3:29 am
Rating: G