Tap / click on image to see more RealViewsTM
Sale Price $3.53.  
Original Price $4.70 per card
You save 25%

Simple Black and White Script Save The Date

Qty:
Choose Your Format
Squared
+$0.35
+$0.40
+$0.40
+$0.40
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$1.00
+$1.00
-$0.30

Other designs from this category

About Flat Save The Date Cards

Sold by

Size: 12.7 cm x 17.8 cm

Hip hip hooray, it's time to spread the good cheer; a date so important you have to save it!

  • Dimensions: 12.7 cm L x 17.8 cm H (portrait); 17.8 cm L x 12.7 cm H (landscape)
  • High-quality, full-colour, full-bleed printing on both sides
  • Add personal photos and text for no additional upcharge
  • Envelopes included but can be removed if not needed

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Simple Black and White Script Save The Date

Simple Black and White Script Save The Date

This simple black and white save the date card features a pretty script save the date with a leaf motif, set above your details in an elegant modern text.

Customer Reviews

4.8 out of 5 stars rating2.5K Total Reviews
2176 total 5-star reviews210 total 4-star reviews43 total 3-star reviews21 total 2-star reviews27 total 1-star reviews
2,477 Reviews
Reviews for similar products
5 out of 5 stars rating
By M.25 March 2024Verified Purchase
Flat Save The Date Card, Size: 13.3 cm x 13.3 cm, Paper: Signature Matte, Corner: Circle
The quality was amazing, I ’m so impressed! There was no blurring at all and it came packaged securely so even though it was delivered in the rain, not one item was damaged. I would 120% recommend and order again. Beautiful, nice and clear
5 out of 5 stars rating
By L.5 July 2023Verified Purchase
Flat Save The Date Card, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Corner: Squared
Zazzle Reviewer Program
Our save the dates are beautiful! Paper and printing are great quality and so affordable! And they arrived so fast! We have just placed an order for all of our wedding invitation stationary and will also be purchasing more as the wedding approaches. The design came out exactly as I hoped! The colours are all perfect!
5 out of 5 stars rating
By L.30 May 2021Verified Purchase
Flat Save The Date Card, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Corner: Squared
Zazzle Reviewer Program
Great quality, look, feel and print! Over sized for posting in AU but still worth the extra stamp! Loved the print quality

Tags

Flat Save The Date Cards
save the date weddinganniversary save the dateengagement save the datescriptblack and whitesimplechicelegantstylishleaf motif
All Products
save the date weddinganniversary save the dateengagement save the datescriptblack and whitesimplechicelegantstylishleaf motif

Other Info

Product ID: 256766060584492636
Added on 5/12/19, 8:50 am
Rating: G