Tap / click on image to see more RealViewsTM
The foil details are simulated in the artwork. No actual foil will be used in the making of this product.
Sale Price $31.32.  
Original Price $41.75 per pack of 100
You save 25%

Silver Frame / Cursive Typography Mini Business Card

Qty:
Standard Semi-Gloss

16 pt thickness / 400 GSM weight
Bright white, semi-gloss finish

+$5.60
+$5.60
+$5.60
+$11.20
+$11.20

Other designs from this category

About Business Cards

Sold by

Size: Mini, 76 mm x 25 mm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 76 mm x 25 mm
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Standard Semi-Gloss

Our most versatile and economical paper, Standard Semi-Gloss produces crisp, vibrant images with exceptional colour and detail—a solid choice for all your printing needs.

  • 16 pt thickness / 400 GSM weight
  • Bright white, semi-gloss finish
  • 50% recycled content
  • Paper imported from Italy

About This Design

The foil details are simulated in the artwork. No actual foil will be used in the making of this product.
Silver Frame / Cursive Typography Mini Business Card

Silver Frame / Cursive Typography Mini Business Card

Add your text and company information on these template ready business cards. Recommended best on a heavy stock paper for higher print quality and more protective substrate. For any design requests contact the designer. ©2010 Joshua Martin

Customer Reviews

4.7 out of 5 stars rating39.3K Total Reviews
32865 total 5-star reviews3862 total 4-star reviews1003 total 3-star reviews626 total 2-star reviews977 total 1-star reviews
39,333 Reviews
Reviews for similar products
4 out of 5 stars rating
By Elizabeth S.6 May 2024Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle provides a way to modify the card designs & that is very useful. My order arrived 2 weeks from tthe order date. The card looks great. I would have liked some more design options such as stock images, such as some wedding rings, which I would have liked to include on my business card. Packaging - one suggestion for improvement - post in a sturdy postal box. Mine were in a small box, inside a flat postal bag. During postage the box had been squashed & all my 100 cards were loose inside the postal bsg. Fortunately none were damaged. Looks great. Option to have raised letters would be a welcome additionsl option.
5 out of 5 stars rating
By Shauna Y.1 November 2021Verified Purchase
Business Card, Size: Mighty, 89 mm x 64 mm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle Reviewer Program
This product was just what I was hoping for. It arrived faster than I expected and exceeded my expectations. The design turned out perfect and I was blown away with the quality and detail of the product. I have since bought 300 more.
5 out of 5 stars rating
By Ronnie A.5 January 2020Verified Purchase
Business Card, Size: Square, 64 mm x 64 mm,Paper: Signature UV Matte, Corners: Squared
Zazzle Reviewer Program
I ordered these cards as my business cards and I could not be happier. Beautiful quality card, clear writing and vibrant colours. I love the square size, they stand out as being different. They arrived a lot sooner than expected as well which was a pleasant surprise. Gorgeous vibrant colours, clear printing, I couldn't have asked for more.

Tags

Business Cards
fashion designerminimalistsimpleelegantlawyerfashion bloggerboutiqueuniquesilver foilfinance
All Products
fashion designerminimalistsimpleelegantlawyerfashion bloggerboutiqueuniquesilver foilfinance

Other Info

Product ID: 240010312512147661
Added on 16/12/17, 11:55 pm
Rating: G