Tap / click on image to see more RealViewsTM
The foil details are simulated in the artwork. No actual foil will be used in the making of this product.
$41.75
per pack of 100
 

Silver Frame / Cursive Typography Mini Business Card

Qty:
Standard Semi-Gloss

16 pt thickness / 400 GSM weight
Bright white, semi-gloss finish

+$5.60
+$5.60
+$5.60
+$11.20
+$11.20

Other designs from this category

About Business Cards

Sold by

Size: Mini, 76 mm x 25 mm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 76 mm x 25 mm
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Standard Semi-Gloss

Our most versatile and economical paper, Standard Semi-Gloss produces crisp, vibrant images with exceptional colour and detail—a solid choice for all your printing needs.

  • 16 pt thickness / 400 GSM weight
  • Bright white, semi-gloss finish
  • 50% recycled content
  • Paper imported from Italy

About This Design

The foil details are simulated in the artwork. No actual foil will be used in the making of this product.
Silver Frame / Cursive Typography Mini Business Card

Silver Frame / Cursive Typography Mini Business Card

Add your text and company information on these template ready business cards. Recommended best on a heavy stock paper for higher print quality and more protective substrate. For any design requests contact the designer. ©2010 Joshua Martin

Customer Reviews

4.7 out of 5 stars rating38.8K Total Reviews
32520 total 5-star reviews3843 total 4-star reviews962 total 3-star reviews583 total 2-star reviews873 total 1-star reviews
38,781 Reviews
Reviews for similar products
4 out of 5 stars rating
By Elizabeth S.6 May 2024Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle provides a way to modify the card designs & that is very useful. My order arrived 2 weeks from tthe order date. The card looks great. I would have liked some more design options such as stock images, such as some wedding rings, which I would have liked to include on my business card. Packaging - one suggestion for improvement - post in a sturdy postal box. Mine were in a small box, inside a flat postal bag. During postage the box had been squashed & all my 100 cards were loose inside the postal bsg. Fortunately none were damaged. Looks great. Option to have raised letters would be a welcome additionsl option.
5 out of 5 stars rating
By Shauna Y.1 November 2021Verified Purchase
Business Card, Size: Mighty, 89 mm x 64 mm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle Reviewer Program
This product was just what I was hoping for. It arrived faster than I expected and exceeded my expectations. The design turned out perfect and I was blown away with the quality and detail of the product. I have since bought 300 more.
5 out of 5 stars rating
By Breearne P.20 August 2021Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
This product arrived fast, packaged with care and the quality of the product is amazing. Overall would definitely be buying from zazzle again and am so impressed with this product. Amazing, clear, good quality. Better than I expected!

Tags

Business Cards
fashion designerminimalistsimpleelegantlawyerfashion bloggerboutiqueuniquesilver foilfinance
All Products
fashion designerminimalistsimpleelegantlawyerfashion bloggerboutiqueuniquesilver foilfinance

Other Info

Product ID: 240010312512147661
Added on 16/12/17, 11:55 pm
Rating: G