Tap / click on image to see more RealViewsTM
The foil details are simulated in the artwork. No actual foil will be used in the making of this product.
Sale Price $22.44.  
Original Price $28.05 per pack of 50
You save 20%

Silver Frame / Cursive Typography Mini Business Card

Qty:
  1. Size

  2. Paper

Other designs from this category

About Business Cards

Sold by

Size: 76 mm x 25 mm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 76 mm × 25 mm
  • Full colour CMYK print process
  • Double sided printing for no additional cost

Paper: Standard Semi-Gloss

Our most versatile and economical paper, Standard Semi-Gloss produces crisp, vibrant images with exceptional colour and detail—a solid choice for all your printing needs.

  • 16 pt thickness / 150 lb weight / 400 GSM
  • Bright white, semi-gloss finish
  • 50% recycled content

About This Design

The foil details are simulated in the artwork. No actual foil will be used in the making of this product.
Silver Frame / Cursive Typography Mini Business Card

Silver Frame / Cursive Typography Mini Business Card

Add your text and company information on these template ready business cards. Recommended best on a heavy stock paper for higher print quality and more protective substrate. For any design requests contact the designer. ©2010 Joshua Martin

Customer Reviews

4.7 out of 5 stars rating41.3K Total Reviews
34059 total 5-star reviews3954 total 4-star reviews1127 total 3-star reviews766 total 2-star reviews1349 total 1-star reviews
41,255 Reviews
Reviews for similar products
4.0 out of 5 stars rating
4 out of 5 stars rating
By Elizabeth S.6 May 2024 • Verified Purchase
Business Card, Size: 89 mm x 51 mm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle provides a way to modify the card designs & that is very useful. My order arrived 2 weeks from tthe order date. The card looks great. I would have liked some more design options such as stock images, such as some wedding rings, which I would have liked to include on my business card. Packaging - one suggestion for improvement - post in a sturdy postal box. Mine were in a small box, inside a flat postal bag. During postage the box had been squashed & all my 100 cards were loose inside the postal bsg. Fortunately none were damaged. Looks great. Option to have raised letters would be a welcome additionsl option.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Wendy B.10 March 2024 • Verified Purchase
Business Card, Size: 89 mm x 64 mm,Paper: Signature Matte, Corners: Squared
I’ve purchased these a couple of times now as Thank you Cards and candle care instructions on the other side.and I’ll keep ordering them! The turnaround from ordering to delivery was extremely quick. My customers love the quality and size of these amazing cards so much that a lot of them ordered the cards themselves! Highly recommend! The printing of these cards are perfect! The print is very easy to read.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Diane B.19 March 2024 • Verified Purchase
Business Card, Size: 64 mm x 64 mm,Paper: Signature Matte, Corners: Squared
I do love these square cards I had to redo them twice, yet wasn’t too happy as I had made the writing smaller on the back even though I thought I’d made it bigger. Yet they still great 😊 Still used them for my event. I could of designed the writing on the back better than I did it came out a little small yet still happy with them I still used them

Tags

fashion designerminimalistsimpleelegantlawyerfashion bloggerboutiqueuniquesilver foilfinance

Other Info

Product ID: 240010312512147661
Added on 16/12/17, 11:55 pm
Rating: G