Tap / click on image to see more RealViewsTM
$11.75
per sticker
 

Saigon Ho Chi Minh City HCMC Vietnam Sunset

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Medium 15.24 cm x15.24 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 15.24 cm L x 16.51 cm H
  • Design Area: 15.24 cm L x 15.24 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Saigon Ho Chi Minh City HCMC Vietnam Sunset

Saigon Ho Chi Minh City HCMC Vietnam Sunset

Saigon or Ho Chi Minh City skyline in Vietnam with sunset cityscape souvenir for Southeast Asia vacation. Saigon Ho Chi Minh City with Skyline in Vietnam as a souvenir for Asia and HCMC. Saigon Sunset Ho Chi Minh City Panorama Lifestyle for Urban Backpackers and Vietnamese City Trip. Saigon Panorama Ho Chi Minh City in Southeast Asia and Vietnam sunset cityscape design souvenir. Saigon Ho Chi Minh City city design for travel to HCMC and Asia or South Vietnam. Saigon Ho Chi Minh City with skyline for Vietnam vacation. You can easily customise and personalise the design by enter the name you want.

Customer Reviews

4.6 out of 5 stars rating26 Total Reviews
21 total 5-star reviews2 total 4-star reviews1 total 3-star reviews1 total 2-star reviews1 total 1-star reviews
26 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous20 October 2024Verified Purchase
Good quality stickers.
Original product
3 out of 5 stars rating
By Harry S.7 March 2024Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Prefer something I could hang of my suitcase. QR code goes no where. Print was ok. Thinner than I thought
5 out of 5 stars rating
By Chandler A.23 August 2023Verified Purchase
Small 10.16 cm x10.16 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
The decal is perfect...it arrived ahead of schedule, was well priced and functions as a nice give away for our customers. It adheres well too. Chandler. Great job...the printing is very clear...
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
saigonho chi minh cityskylinevietnamcityscapehcmcsunsetpanoramaretrocity
All Products
saigonho chi minh cityskylinevietnamcityscapehcmcsunsetpanoramaretrocity

Other Info

Product ID: 256998807896294676
Added on 17/6/23, 5:33 am
Rating: G