Tap / click on image to see more RealViewsTM
$43.00
per shirt
 

Riding the Wave to Success T-shirt

Qty:
Basic Dark T-Shirt
-$2.00
+$14.30
Black
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Basic Dark T-Shirt

Comfortable, casual and loose fitting, our heavyweight dark colour t-shirt will quickly become one of your favorites. Made from 100% cotton, it's unisex and wears well on anyone and everyone. We’ve double-needle stitched the bottom and sleeve hems for extra durability. Select a design from our marketplace or customise it to make it uniquely yours!

Size & Fit

  • Model is 188 cm and is wearing a medium
  • Standard fit
  • Garment is unisex sizing
  • Fits true to size

Fabric & Care

  • 100% cotton (Heathers are a cotton/poly blend)
  • Double-needle hemmed sleeves and bottom
  • Imported
  • Machine wash cold

About This Design

Riding the Wave to Success T-shirt

Riding the Wave to Success T-shirt

This t-shirt design features a line graph that climbs steadily up a mountain peak, reaching the summit. The design is perfect for new trading graphics designers who are looking to show off their skills and determination. The mountain motif represents the challenges and rewards of trading, while the line graph symbolises success.

Customer Reviews

4.7 out of 5 stars rating32.2K Total Reviews
25248 total 5-star reviews4958 total 4-star reviews1084 total 3-star reviews488 total 2-star reviews450 total 1-star reviews
32,228 Reviews
Reviews for similar products
5 out of 5 stars rating
By Robert C.1 March 2022Verified Purchase
Basic Dark T-Shirt, Black, Adult L
Creator Review
I purchased this to test to see if zazzle was producing good quality. Needless to say, they are. The sizing runs a bit on the small size though. Print quality is perfect. What you see on the screen is what you get.
5 out of 5 stars rating
By Xavier D.3 February 2021Verified Purchase
Basic Dark T-Shirt, Black, Adult M
Creator Review
I like the colours and design, I liked it that much I bought one for myself. Yes the colours and deisgn turned out great. Much better than I expected
5 out of 5 stars rating
By Rachel R.4 September 2025Verified Purchase
Basic Dark T-Shirt, Black, Adult S
Ordered the Irish terrier t shirt. I love it! There was a slight issue with sizing ( my fault) but their customer service was amazing. New t shirt within 5 days. I recommend getting 1 to 2 sizes bigger. I am wearing Men's size large.

Tags

T-Shirts
tradinggraphicstshirtdesignnewdesigneefinancialmarketsmountainmotiflinegraphsuccesstiger
All Products
tradinggraphicstshirtdesignnewdesigneefinancialmarketsmountainmotiflinegraphsuccesstiger

Other Info

Product ID: 256145644063570158
Added on 29/3/24, 11:27 pm
Rating: G