Tap / click on image to see more RealViewsTM
The foil and rose gold elements are simulated in the artwork by the Creator. These elements will not be used in the making of this product.Browse real foil products
Sale Price $3.27.  
Original Price $4.35 per card
You save 25%

Retirement Party Elegant Pink Rose Gold Feminine Invitation

Qty:
Choose Your Format
Squared
+$0.35
+$0.40
+$0.40
+$0.40
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$0.95
+$0.95
-$0.25

Other designs from this category

About Invitations

Sold by

Size: 12.7 cm x 17.8 cm

Make custom invitations and announcements for every special occasion! Choose from various curated paper types, shapes and sizes to design a card that's perfect for you.

  • Dimensions: 12.7 cm x 17.8 cm (portrait or landscape)
  • Envelopes included but can be removed if not needed
  • High quality, full-colour, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Various curated paper types to choose from
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 12.7 cm x 17.8 cm. For best results please add 0.16 cm bleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

The foil and rose gold elements are simulated in the artwork by the Creator. These elements will not be used in the making of this product.Browse real foil products
Retirement Party Elegant Pink Rose Gold Feminine   Invitation

Retirement Party Elegant Pink Rose Gold Feminine Invitation

This elegant pink and rose gold retirement party invitation with a vintage air, recommended for a woman, has an ornate (faux) rose gold foil frame with elegant baroque decorations on a blush pink background. The name is written in an elegant calligraphy. All text can be personalised and has a pink colour similar to the rose gold frame. The vintage, ornate frame is based on an antique French book cover binding, by Georges Mercier (1885-1939) - Madame de Maupin by Teophile Gautier, edition 1911, now in the public domain.

Customer Reviews

4.8 out of 5 stars rating71.1K Total Reviews
62833 total 5-star reviews5793 total 4-star reviews1095 total 3-star reviews525 total 2-star reviews872 total 1-star reviews
71,118 Reviews
Reviews for similar products
5 out of 5 stars rating
By Sue M.17 January 2025Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
My invites arrived on time and beautiful quality. Definitely was worried for my first order but will definitely order from Dazzle in the future.
5 out of 5 stars rating
By k.4 December 2017Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
I customised and ordered 30 of these cards for my Mum, to be used as guest place cards on the birthday table at our local restaurant venue. The design caught my eye while I was perusing all the samples, and thought it was a great novel idea for my steam train enthusiast Dad. I chose the larger postcard sized one, as the font would be large for older eyes, and customised it keeping the Rail Ticket theme on the front, with venue address/date/time of party, and on the back I added another steam train and various 80 speed limit/rail signages. The trick is not to overdo it or it looks too busy. I also added at one end of the front side, a word of thanks from the birthday boy. Champagne Shimmer was chosen for the finish and it suited the card so well, as it gave an glimmer of elegance and richness, loved it. During the party, I had guests come up to me and say how much they liked this quirky card. My Mum was ecstatic (she is hard to please at the best of times) and my Dad liked them very much also. Upon leaving the party venue, I noticed that not one single card was left behind at our guest table.....so to me it spoke volumes, that the guests appreciated the cards enough to want to take them home as mementos. I couldn't have wished for a better place card for Dad's 80th birthday party. Thanks Zazzle! Very happy with the finished product. Design turned out well, front and back. I kept with original background and border colouring, which went extremely well with my choice of Champagne Shimmer for the finish. I kept to minimal colour pictures added on the back, they printed up very well. All crisp and clean. The cards looked a million dollars!
5 out of 5 stars rating
By Jaids K.13 March 2020Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
It was better than I could’ve ever imagined and so easy to create! Why spend hundreds of dollars to get a invitation company to produce something you can do yourself! Better than I could’ve ever imagined!

Tags

All Products
retirement partyelegantblush pinkrose goldfemininevintagecalligraphyscriptornateantique

Other Info

Product ID: 256290993018250813
Added on 10/8/25, 12:56 pm
Rating: G