Tap / click on image to see more RealViewsTM
$72.25
per set of 50 napkins
 

Purple Pink Blue Butterfly Bridal Shower Napkin

Wedding Collection
Qty:
White

Other designs from this category

Shop this collection

Tap / click on image to see more RealViewsTM
 
 
 
 
 
 
 
 

About Paper Napkins

Sold by

Style: Standard Cocktail

A good celebration is as much about the presentation as it is about food. Serve up the party with custom personalised paper napkins that look good tucked in the collar or draped over your lap.

  • Dimensions: 12 cm l x 12 w cm (folded), 3 ply
  • Printed in full colour on your choice of white or ecru coloured napkins
  • Coined or standard napkin styles available
  • Sold in quantities of 50
  • Buy in bulk and save!
  • This product is food contact safe
Tip: When ordering napkins, the general rule is 3 napkins per guest.

About This Design

Purple Pink Blue Butterfly Bridal Shower Napkin

Purple Pink Blue Butterfly Bridal Shower Napkin

Personalise this exquisite Butterfly Bridal Shower Paper Napkin, a charming addition to your celebration. Embrace the whimsical beauty of fluttering pink, blue, and purple butterflies delicately adorned against a crisp white background. Each napkin is adorned with soft tones, featuring delicate white flowers intertwined with the elegant butterfly motif, creating a picturesque scene that exudes both femininity and grace. Featuring a boho floral design, these paper napkins effortlessly elevate any bridal shower decor, adding a touch of enchantment and sophistication to your event. Whether you're hosting a bridal shower party, picnic or a lavish affair, these pretty napkins are sure to impress your guests with their timeless elegance.

Customer Reviews

4.7 out of 5 stars rating1.3K Total Reviews
1138 total 5-star reviews91 total 4-star reviews36 total 3-star reviews24 total 2-star reviews55 total 1-star reviews
1,344 Reviews
Reviews for similar products
5 out of 5 stars rating
By ShazZy B.15 July 2019Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
Great quality napkins, pretty florals that match the Invites, Favour tags & labels. Speedy shipping, packed well so no damage. True to colour, floral stayed the same great quality across all products purchased, very happy & highly recommend all these items.
5 out of 5 stars rating
By Jennifer W.7 December 2024Verified Purchase
Paper Napkins, Standard Cocktail
Simply lovely, beautifully done with fast delivery.. I have purchased many products from Zazzle, so pleased with them all.
5 out of 5 stars rating
By A.24 August 2022Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
I absolutely love this product. I couldn't find anything like this in Australia so I was over the moon to find exactly what I wanted at a fair price. They feel great and look adorable. A great little addition to my wedding stationary. Definitely recommend! :). Some text is a tiny bit blurry but that's expected considering I added a lot of text. Super happy with it either way!

Tags

Paper Napkins
butterfly bridal showerpurplepinkblueboho floralflowersbridal showercalligraphywhimsicalfeminine
All Products
butterfly bridal showerpurplepinkblueboho floralflowersbridal showercalligraphywhimsicalfeminine

Other Info

Product ID: 256280182806499442
Added on 10/9/24, 3:06 am
Rating: G