Tap / click on image to see more RealViewsTM
$64.40
per clipboard
 

Pretty Pink Floral Script Monogram Initial Name Clipboard

Qty:
Personalise this template

Other designs from this category

About Clipboard

Sold by

Style: Clipboard

Stay organised, and stunningly stylish, with custom clipboards from Zazzle! Use your favourite design, images or text to transform this basic school supply into a stunning accessory, that will keep you on track, always!

  • Dimensions: 31.75 cm L x 22.86 cm W; thickness: 0.31 cm
  • Designed for letter and A4 sized paper
  • Holds up to 1.27 cm of paper securely
  • Made of ultra-durable acrylic
  • Printed on both sides
  • /!\WARNING: CHOKING HAZARD - small parts.
  • Not for children under 3 yrs.

About This Design

Pretty Pink Floral Script Monogram Initial Name Clipboard

Pretty Pink Floral Script Monogram Initial Name Clipboard

Pretty, modern and elegant, this trendy clipboard design features a hand painted watercolor floral motif in the corner, with your name and monogram initial in pink and soft grey hand lettered script typography, and is bordered in matching pink. Copyright Anastasia Surridge for Personalised Home Decor, all rights reserved.

Customer Reviews

4.9 out of 5 stars rating391 Total Reviews
353 total 5-star reviews27 total 4-star reviews4 total 3-star reviews6 total 2-star reviews1 total 1-star reviews
391 Reviews
Reviews for similar products
5 out of 5 stars rating
By Meleate K.29 July 2019Verified Purchase
Clipboard
Zazzle Reviewer Program
I absolutely loved this clipboard! I bought it because I was starting out my lash business and needed a clipboard for clients to fill out their waiver forms. I loved how it was so easy to create and customize. Everything about it looked so good online and when it came in the mail it was even better than I expected! The moment I received it in the mail I couldn't stop showing it off to everyone who came over! I give zazzle all together 5 stars! I would so recommend this to everyone I know. The printing was great, it was blurred out at all.
5 out of 5 stars rating
By Patricia t.26 August 2023Verified Purchase
Clipboard
Zazzle Reviewer Program
I just wish it had a extra gloss texture to shine but I love it anyway!!! Thanks so much !!! .
from zazzle.com (US)
5 out of 5 stars rating
By A.4 April 2019Verified Purchase
Clipboard
Zazzle Reviewer Program
I love this clipboard and get many compliments on it. It's heavy duty and makes me happy looking at the vacation pictures! It goes to the gym with me, holding my workouts. Pictures are excellent and site was easy to use.
from zazzle.com (US)

Tags

Clipboard
pinkgirlyprettychicscriptelegantinitialnamefloralmonogram
All Products
pinkgirlyprettychicscriptelegantinitialnamefloralmonogram

Other Info

Product ID: 256132108931783769
Added on 20/10/21, 5:13 pm
Rating: G