Tap / click on image to see more RealViewsTM
$74.20
per clipboard
 

Pretty Pink Floral Script Monogram Initial Name Clipboard

Qty:

Other designs from this category

About Clipboard

Sold by

Style: Clipboard

Stay organised, and stunningly stylish, with custom clipboards from Zazzle! Use your favourite design, images or text to transform this basic school supply into a stunning accessory, that will keep you on track, always!

  • Dimensions: 31.75 cm L x 22.86 cm W; thickness: 0.31 cm
  • Designed for letter and A4 sized paper
  • Holds up to 1.27 cm of paper securely
  • Made of ultra-durable acrylic
  • Printed on both sides
  • /!\WARNING: CHOKING HAZARD - small parts.
  • Not for children under 3 yrs.

About This Design

Pretty Pink Floral Script Monogram Initial Name Clipboard

Pretty Pink Floral Script Monogram Initial Name Clipboard

Pretty, modern and elegant, this trendy clipboard design features a hand painted watercolor floral motif in the corner, with your name and monogram initial in pink and soft grey hand lettered script typography, and is bordered in matching pink. Copyright Anastasia Surridge for Personalised Home Decor, all rights reserved.

Customer Reviews

4.8 out of 5 stars rating400 Total Reviews
358 total 5-star reviews27 total 4-star reviews5 total 3-star reviews7 total 2-star reviews3 total 1-star reviews
400 Reviews
Reviews for similar products
5 out of 5 stars rating
By Meleate K.29 July 2019Verified Purchase
Clipboard
Zazzle Reviewer Program
I absolutely loved this clipboard! I bought it because I was starting out my lash business and needed a clipboard for clients to fill out their waiver forms. I loved how it was so easy to create and customize. Everything about it looked so good online and when it came in the mail it was even better than I expected! The moment I received it in the mail I couldn't stop showing it off to everyone who came over! I give zazzle all together 5 stars! I would so recommend this to everyone I know. The printing was great, it was blurred out at all.
5 out of 5 stars rating
By Patricia t.26 August 2023Verified Purchase
Clipboard
Zazzle Reviewer Program
I just wish it had a extra gloss texture to shine but I love it anyway!!! Thanks so much !!! .
from zazzle.com (US)
5 out of 5 stars rating
By Kaitlyn B.8 January 2026Verified Purchase
Clipboard
Absolute masterpiece. Got this clip board as a Christmas gift for my coach and it turned out AMAZING and is dry-erase. Designed it using canvas and adobe and it looked exactly like the picture. It came late although I paid for express shipping because it was around Christmas time. #10000 percent would recommend again. I couldn’t upload a photo of the front but my design is attached without the wording. .
from zazzle.com (US)

Tags

Clipboard
pinkgirlyprettychicscriptelegantinitialnamefloralmonogram
All Products
pinkgirlyprettychicscriptelegantinitialnamefloralmonogram

Other Info

Product ID: 256132108931783769
Added on 20/10/21, 5:13 pm
Rating: G