Tap / click on image to see more RealViewsTM
$17.00
per sticker
 

Playful friends drawing on

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Large 20.32 cm x 20.32 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 20.32 cm L x 21.59 cm H
  • Design Area: 20.32 cm L x 20.32 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Playful friends drawing on

Playful friends drawing on

Playful friends drawing design.

Customer Reviews

4.8 out of 5 stars rating11 Total Reviews
10 total 5-star reviews0 total 4-star reviews1 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
11 Reviews
Reviews for similar products
5 out of 5 stars rating
By Marie S.1 June 2021Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
Looks great! A variety of bright color designs for fun and whimsy. Gift for a book loving sister who gave me (the artist) lots of feedback on the design. These are Custom-Cut Vinyl Sticker and low tack ~ very cool! Very pleased. It comes with a choice of each sticker with a white outline. In hindsight the clear option would have been preferred but depends on it's placement too. Fun!
from zazzle.com (US)
5 out of 5 stars rating
By Alaenya H.13 January 2022Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
My niece was born in AZ and she wanted a sticker for her water bottle from where she was born. She loved this design. The image quality was beautiful!
from zazzle.com (US)
5 out of 5 stars rating
By Melanie B.18 August 2021Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
The sticker material is quite thick and durable. I would compare the quality to a typical vinyl bumper sticker. Not easy to scratch but definitely able to tear if you peel it off too quickly. Color match for a specific shade of red was perfect! The logo looks a tad blurry but that's likely because the original image I uploaded was not of the best quality. Would highly recommend uploading a vectorized image rather than pixelated if you're looking for sharp lines.
from zazzle.com (US)

Tags

All Products
boygirlfriendsdrawingwhitepatternplayhappysmile

Other Info

Product ID: 256993414820906350
Added on 1/6/22, 11:28 am
Rating: G