Tap / click on image to see more RealViewsTM
The glitter details are simulated in the artwork. No actual glitter will be used in the making of this product.
Sale Price $35.53.  
Original Price $50.75 per pack of 100
You save 30%

Personalized Gold Shiny Heart Glitter Vip Business Card

Qty:
Squared
+$11.05
Signature UV Matte

18 pt thickness / 325 GSM
Bright white, matte finish

-$9.80
-$9.80
+$9.75
+$9.75
+$9.75
+$9.75
+$9.75
+$9.75
+$27.25

Other designs from this category

About Business Cards

Sold by

Size: American, 89 mm x 51 mm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 89 mm x 51 mm
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature UV Matte

An upgrade from our Standard Matte, Signature UV Matte features a thicker and stiffer paper coated with a protective finish. It provides the perfect base for creating long-lasting, high-quality designs with robust colour and detail.

  • 18 pt thickness/ 325 GSM
  • Bright white, matte finish
  • UV coating adds an additional layer of protection

About This Design

The glitter details are simulated in the artwork. No actual glitter will be used in the making of this product.
Personalized Gold Shiny Heart Glitter Vip Business Card

Personalized Gold Shiny Heart Glitter Vip Business Card

Make a dazzling impression with the "Personalized Gold Shiny Heart Glitter VIP Business Card," designed to reflect the utmost elegance and exclusivity. This business card is ideal for professionals in the beauty, fashion, or luxury service industries who wish to communicate a sense of sophistication and VIP status to every interaction. The card features a luxurious gold background embellished with a subtle glitter effect, creating a shimmering canvas that catches the light and eyes alike. Central to the design is a shiny heart symbol, representing passion and care in your professional engagements. This heart motif is not only stylish but also conveys a message of love and dedication to your craft or service. Personalization is at the forefront of this design. You can customize the card with your name, title, and contact details, showcased in an elegant font that complements the card's opulent theme. The layout is meticulously crafted to balance aesthetics and readability, ensuring that your essential information is both prominent and beautiful. Printed on high-quality cardstock, these business cards have a glossy finish that enhances the golden hues and glitter, making each handover feel significant and exclusive. The premium material and print quality ensure that the card withstands the test of time and handling, embodying the durability and permanence of your professional relationships. Ideal for networking events, client meetings, or as a daily reminder of your professional image, the "Personalized Gold Shiny Heart Glitter VIP Business Card" is more than just a tool for sharing contact information—it's a statement of your commitment to excellence and luxury. #LuxuryBranding #ElegantNetworking #VIPExperience ✨💖👑

Customer Reviews

4.7 out of 5 stars rating38.4K Total Reviews
32259 total 5-star reviews3829 total 4-star reviews937 total 3-star reviews560 total 2-star reviews823 total 1-star reviews
38,408 Reviews
Reviews for similar products
4 out of 5 stars rating
By Elizabeth S.6 May 2024Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle provides a way to modify the card designs & that is very useful. My order arrived 2 weeks from tthe order date. The card looks great. I would have liked some more design options such as stock images, such as some wedding rings, which I would have liked to include on my business card. Packaging - one suggestion for improvement - post in a sturdy postal box. Mine were in a small box, inside a flat postal bag. During postage the box had been squashed & all my 100 cards were loose inside the postal bsg. Fortunately none were damaged. Looks great. Option to have raised letters would be a welcome additionsl option.
5 out of 5 stars rating
By Shauna Y.1 November 2021Verified Purchase
Business Card, Size: Mighty, 89 mm x 64 mm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle Reviewer Program
This product was just what I was hoping for. It arrived faster than I expected and exceeded my expectations. The design turned out perfect and I was blown away with the quality and detail of the product. I have since bought 300 more.
5 out of 5 stars rating
By Breearne P.20 August 2021Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
This product arrived fast, packaged with care and the quality of the product is amazing. Overall would definitely be buying from zazzle again and am so impressed with this product. Amazing, clear, good quality. Better than I expected!

Tags

Business Cards
goldglampeachpinkshinyvipglitterbeautystylistmake
All Products
goldglampeachpinkshinyvipglitterbeautystylistmake

Other Info

Product ID: 240958605074950049
Added on 27/4/16, 9:48 am
Rating: G