Tap / click on image to see more RealViewsTM
$8.55
per sticker
 

Pam Happy Birthday silver Sticker

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Small 10.16 cm x10.16 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 10.16 cm L x 11.43 cm H
  • Design Area: 10.16 cm L x 10.16 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Pam Happy Birthday silver Sticker

Pam Happy Birthday silver Sticker

A very nice stylish personalized sticker / sticker for Pam. The name as text and happy Birthday is available in different sizes and also in transparent. Perfect for you, your best friend, wife, sister, mother, aunt, grandma, fiancée, cousin, partner or whatever you want to surprise with a personal and individual gift. Please check our shop for more products as a gift idea with this name. Here you will find many more personalized products and designs.

Customer Reviews

4.6 out of 5 stars rating1.1K Total Reviews
901 total 5-star reviews65 total 4-star reviews25 total 3-star reviews21 total 2-star reviews61 total 1-star reviews
1,073 Reviews
Reviews for similar products
5 out of 5 stars rating
By C.1 March 2021Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I'm super happy with this beautiful Owl Mandala transfer. It suits my car perfectly. If I could have bought a bigger one, I would've! High-quality printing and materials. I believe the transfer will be relatively weather-resistant. Only time will tell.
5 out of 5 stars rating
By Blake C.12 October 2020Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
To be honest, I wasn't expecting much, as I am using these stickers as a decal for my ute doors. That being said, it is extremely affordable, and to get these done on another website I saw, they wanted to charge me over $100 for smaller. These stickers are amazing quality and well worth the money. By far exceeded my expectations and will do the job nicely. The stick great. The only thing I would change is instead of a cut out of each part, if they'd have the backing, sticker, then clear over the top for easy application because the moment I tore off the front to apply the sticker, the lettering stayed on the backing paper causing me to have to use the front as a boarder/stencil and carefully apply the lettering inside the lines. But either way, I'm very happy. Thank you. The printing was awesome. Top quality and no issues whatsoever. As I stated in the "what I thought about this product" section, The only thing I would change is instead of a cut out of each part, if they'd have the backing paper, sticker, then clear over the top that the front of the sticker sticks to for easy application in one go. Because the moment I tore off the front to apply the sticker, the lettering stayed on the backing paper causing me to have to use the front as a boarder/stencil and carefully apply the lettering inside the lines
4 out of 5 stars rating
By Galit B.28 December 2023Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
The stick looks amazing. Unfortunately, it would not stick on our suitcase as it was textured. When we found a non-textured (smooth) suitcase, the sticker stuck and looks great. The printing looked awesome.

Tags

Custom-Cut Vinyl Stickers
All Products
firstnamebirthdayhappystickerheartgiftpam

Other Info

Product ID: 256046860064507502
Added on 20/3/21, 3:48 am
Rating: G