Tap / click on image to see more RealViewsTM
$53.35
per window cling
 

Nudimmud

Qty:
76.2cm x 50.8cm
Opaque Design: All-over White Underbase
Rectangle

Other designs from this category

About Window Clings

Sold by

Shape: Rectangle

Turn your glass surfaces into decorations, promotions, signage and more with custom window clings. These versatile and reusable vinyl clings stick to glass surfaces through static electricity so leave no sticky residue behind. From displaying new promotions on your business’s window and using that empty window space to boost your brand, to decorating a window in your home, you’ll find so many great uses for these clings.

  • Dynamically Sized - ranging from 10.16 cm x 10.16 cm (4” x 4”) to a max of 132.08 cm x 182.88 cm (52” x 72”) (or max 182.88 cm x 132.08 cm (72” x 52”) if horizontal/landscape is selected)
  • Material - 7.5 mil static cling vinyl
  • Non Adhesive: Sticks to glass surfaces electro-statically
  • Choose from rectangle or custom cut shapes

Application Instructions:

  • Clean the surface you wish to apply the window cling to with hot water and dishwasher soap and wait until dry
  • Next, apply a light mist of water to your surface. Peel the decal from backing paper and place it on your surface, slide it around until you’re happy with its placement
  • Once it’s positioned perfectly, use a squeegee or flat plastic card to remove any air bubbles and wipe your window dry
  • To reposition or remove, simply peel away. It’s non-adhesive so there’ll be no residue left on the surface

Print Process: Opaque Design: All-over White Underbase

The art is printed on a white sheet of plastic, which enhances the dynamic appearance of colors. Please note that the white sheet is opaque and will obscure text and art when viewed from the back of the window cling.

Adhesive: Cling art faces inward

The adhesive side is on the back of the window cling. All text and art are printed on the front of the window cling and face towards the person applying it to the window. The art and text printed on the window cling will appear correctly when viewed from the same side of the window where it has been applied.

About This Design

Nudimmud

Nudimmud

A fluffy white bird adorned with soft pink and blue feathers, nestled among silky pink and yellow blossoms on a dreamy pastel green background.

Customer Reviews

3.6 out of 5 stars rating229 Total Reviews
131 total 5-star reviews14 total 4-star reviews6 total 3-star reviews15 total 2-star reviews63 total 1-star reviews
229 Reviews
Reviews for similar products
4.0 out of 5 stars rating
4 out of 5 stars rating
By Pirkko B.4 December 2024Verified Purchase
Style: Automatic Opaque Design: White Underbase, Shape: Custom Cut, Display: Back of Cling, Window Cling
Product was nice quality unfortunately I chose the wrong backing which was transparent. I could not see the decal properly .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Joanne S.18 September 2023Verified Purchase
Style: Automatic Opaque Design: White Underbase, Shape: Rectangle, Display: Front of Cling, Window Cling
Zazzle Reviewer Program
Wonderful Product , looks very professional. Perfect, so happy with quality
5.0 out of 5 stars rating
5 out of 5 stars rating
By Evgeny P.6 November 2025Verified Purchase
Style: Automatic Opaque Design: White Underbase, Shape: Rectangle, Display: Back of Cling, Window Cling
Creator Review
Went out stylish. The cut lines are thin, and extra light definitely helps when cutting. Love the end result!
from zazzle.com (US)

Tags

Window Clings
fluffy birdcontemporarymodernflowersvintagepastelpinkgreenyellowbohemian
All Products
fluffy birdcontemporarymodernflowersvintagepastelpinkgreenyellowbohemian

Other Info

Product ID: 256852668622836818
Added on 29/4/26, 1:59 pm
Rating: G