Tap / click on image to see more RealViewsTM
$35.25
per shirt
 

MVK Fighting Together T-Shirt

Qty:
Basic T-Shirt
-$5.90
+$13.75
White
Classic Printing: No Underbase
+$2.00
+$2.00
+$2.00
+$2.00
Vivid Printing: White Underbase
+$9.85
+$9.85
+$9.85
+$9.85

Other designs from this category

About T-Shirts

Sold by

Style: Men's Basic T-Shirt

Comfortable, casual and loose fitting, our heavyweight t-shirt will easily become a closet staple. Made from 100% cotton, it's unisex and wears well on anyone and everyone. We’ve double-needle stitched the bottom and sleeve hems for extra durability.

Size & Fit

  • Model is 185 cm and is wearing a medium
  • Standard fit
  • Garment is unisex sizing
  • Fits true to size

Fabric & Care

  • 100% cotton (Heathers are a cotton/poly blend)
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold, tumble dry low
  • Imported

About This Design

MVK Fighting Together T-Shirt

MVK Fighting Together T-Shirt

Fighting Together supporting Mevalonate kinase deficiency (MVK disease)

Customer Reviews

4.6 out of 5 stars rating56.3K Total Reviews
42850 total 5-star reviews9315 total 4-star reviews2304 total 3-star reviews1043 total 2-star reviews837 total 1-star reviews
56,349 Reviews
Reviews for similar products
5 out of 5 stars rating
By o.25 April 2017Verified Purchase
Basic T-Shirt, White, Adult L
Zazzle Reviewer Program
The Shirt itself is a really nice, high quality material. Its quite thick and the colour is spot on whats in the pictures. The print is 100% what I wanted and the overall product is amazing. I ordered a 2XL which is already pretty big, it came a lot larger than I expected so next time i would order a smaller size, but thats down to me. It came just in time and the staff were super helpful in speeding up the shipping process for me so it would arrive on time. The printing turned out better than i could've imagined. I was very skeptical at first and wasnt sure how it was going to look, but it honestly looks awesome. So happy with it :)
5 out of 5 stars rating
By Anonymous15 December 2024Verified Purchase
Basic T-Shirt, Grey, Adult S
Brilliant in every respect. Great material t shirt, photo better than expected, fast delivery. Trustworthy seller. Thank you. ❤️.
5 out of 5 stars rating
By Marissa T.4 January 2024Verified Purchase
Basic T-Shirt, White, Adult S
Zazzle Reviewer Program
Super easy to order and look so good. Only came 5 days after ordering so super quickly and fits well. Bit baggy but i like my shirts bigger. Really clear looks good

Tags

T-Shirts
fmfandaidglobalautoinflammatorydiseasesmevalonatekinasedeficiencymvkdisease
All Products
fmfandaidglobalautoinflammatorydiseasesmevalonatekinasedeficiencymvkdisease

Other Info

Product ID: 256138967277778890
Added on 23/10/24, 12:28 am
Rating: G